Stop the war!

Остановите войну!

for scientists:

default search action

combined dblp search
author search
venue search
publication search

ask others

Eduard H. Hovy

> Home > Persons

Person information

affiliation: University of Melbourne, Autralia
affiliation: Carnegie Mellon University, Language Technologies Institute, Pittsburgh, PA, USA
affiliation (former): University of Southern California, USA

Refine list

refinements active!

zoomed in on ?? of ?? records

view refined list in

export refined list as

showing all ?? records

Journal Articles

see FAQ

What is the meaning of the colors in the publication lists?

2021
[j44]
- view
  authority control:
- export record
  dblp key:
  - journals/tacl/JoBRH21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tacl/JoBRH21
Yohan Jo, Seojin Bang, Chris Reed, Eduard H. Hovy:
Classifying Argumentative Relations Using Logical Mechanisms and Argumentation Schemes. Trans. Assoc. Comput. Linguistics 9: 721-739 (2021)
[j43]
- view
  authority control:
- export record
  dblp key:
  - journals/tacl/ElazarKRRHSG21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tacl/ElazarKRRHSG21
Yanai Elazar, Nora Kassner, Shauli Ravfogel, Abhilasha Ravichander, Eduard H. Hovy, Hinrich Schütze, Yoav Goldberg:
Measuring and Improving Consistency in Pretrained Language Models. Trans. Assoc. Comput. Linguistics 9: 1012-1031 (2021)
[j42]
- view
  authority control:
- export record
  dblp key:
  - journals/tacl/ElazarKRRHSG21a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tacl/ElazarKRRHSG21a
Yanai Elazar, Nora Kassner, Shauli Ravfogel, Abhilasha Ravichander, Eduard H. Hovy, Hinrich Schütze, Yoav Goldberg:
Erratum: Measuring and Improving Consistency in Pretrained Language Models. Trans. Assoc. Comput. Linguistics 9: 1407 (2021)
2020
[j41]
- view
  authority control:
- export record
  dblp key:
  - journals/tacl/ShibuyaH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tacl/ShibuyaH20
Takashi Shibuya, Eduard H. Hovy:
Nested Named Entity Recognition via Second-best Sequence Learning and Decoding. Trans. Assoc. Comput. Linguistics 8: 605-620 (2020)
[j40]
- view
  authority control:
- export record
  dblp key:
  - journals/ws/IlievskiHVSX20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ws/IlievskiHVSX20
Filip Ilievski, Eduard H. Hovy, Piek Vossen, Stefan Schlobach, Qizhe Xie:
The role of knowledge in determining identity of long-tail entities. J. Web Semant. 61-62: 100565 (2020)
2019
[j39]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/access/PoriaMMH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/access/PoriaMMH19
Soujanya Poria, Navonil Majumder, Rada Mihalcea, Eduard H. Hovy:
Emotion Recognition in Conversation: Research Challenges, Datasets, and Recent Advances. IEEE Access 7: 100943-100953 (2019)
[j38]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/coling/SachanDHMRX19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/coling/SachanDHMRX19
Mrinmaya Sachan, Avinava Dubey, Eduard H. Hovy, Tom M. Mitchell, Dan Roth, Eric P. Xing:
Discourse in Multimedia: A Case Study in Extracting Geometry Knowledge from Textbooks. Comput. Linguistics 45(4): 627-665 (2019)
[j37]
- view
  authority control:
- export record
  dblp key:
  - journals/lre/SutcliffeHCWCR19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/lre/SutcliffeHCWCR19
Richard F. E. Sutcliffe, Eduard H. Hovy, Tom Collins, Stephen Wan, Tim Crawford, Deane L. Root:
Searching for musical features using natural language queries: the C@merata evaluations at MediaEval. Lang. Resour. Evaluation 53(1): 87-140 (2019)
2018
[j36]
- view
  authority control:
- export record
  dblp key:
  - journals/mt/LittellTXSMLTHH18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/mt/LittellTXSMLTHH18
Patrick Littell, Tian Tian, Ruochen Xu, Zaid Sheikh, David R. Mortensen, Lori S. Levin, Francis M. Tyers, Hiroaki Hayashi, Graham Horwood, Steve Sloto, Emily Tagtow, Alan W. Black, Yiming Yang, Teruko Mitamura, Eduard H. Hovy:
The ARIEL-CMU situation frame detection pipeline for LoReHLT16: a model translation approach. Mach. Transl. 32(1-2): 105-126 (2018)
2016
[j35]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/biodb/BurnsDWH16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/biodb/BurnsDWH16
Gully A. P. C. Burns, Pradeep Dasigi, Anita de Waard, Eduard H. Hovy:
Automated detection of discourse segment and experimental types from the text of cancer pathway results sections. Database J. Biol. Databases Curation 2016 (2016)
2013
[j34]
- view
  authority control:
- export record
  dblp key:
  - journals/ai/HovyNP13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ai/HovyNP13
Eduard H. Hovy, Roberto Navigli, Simone Paolo Ponzetto:
Editorial. Artif. Intell. 194: 1 (2013)
[j33]
- view
  authority control:
- export record
  dblp key:
  - journals/ai/HovyNP13a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ai/HovyNP13a
Eduard H. Hovy, Roberto Navigli, Simone Paolo Ponzetto:
Collaboratively built semi-structured content and Artificial Intelligence: The story so far. Artif. Intell. 194: 2-27 (2013)
[j32]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/coling/BhagatH13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/coling/BhagatH13
Rahul Bhagat, Eduard H. Hovy:
What Is a Paraphrase? Comput. Linguistics 39(3): 463-472 (2013)
[j31]
- view
  authority control:
- export record
  dblp key:
  - journals/lre/KozarevaH13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/lre/KozarevaH13
Zornitsa Kozareva, Eduard H. Hovy:
Tailoring the automated construction of large-scale taxonomies using the web. Lang. Resour. Evaluation 47(3): 859-890 (2013)
2012
[j30]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/scfbm/RamakrishnanPHB12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/scfbm/RamakrishnanPHB12
Cartic Ramakrishnan, Abhishek Patnia, Eduard H. Hovy, Gully A. P. C. Burns:
Layout-aware text extraction from full-text PDF of scientific articles. Source Code Biol. Medicine 7: 7 (2012)
2011
[j29]
- view
  authority control:
- export record
  dblp key:
  - journals/bmcbi/RussRHBB11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/bmcbi/RussRHBB11
Thomas A. Russ, Cartic Ramakrishnan, Eduard H. Hovy, Mihail Bota, Gully A. P. C. Burns:
Knowledge Engineering Tools for Reasoning with Scientific Observations and Interpretations: a Neural Connectivity Use Case. BMC Bioinform. 12: 351 (2011)
[j28]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/dagstuhl-manifestos/BourneCDWHHS11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/dagstuhl-manifestos/BourneCDWHHS11
Philip E. Bourne, Timothy W. Clark, Robert Dale, Anita de Waard, Ivan Herman, Eduard H. Hovy, David M. Shotton:
Improving The Future of Research Communications and e-Scholarship (Dagstuhl Perspectives Workshop 11331). Dagstuhl Manifestos 1(1): 41-60 (2011)
[j27]
- view
  authority control:
- export record
  dblp key:
  - journals/nle/RecasensH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/nle/RecasensH11
Marta Recasens, Eduard H. Hovy:
BLANC: Implementing the Rand index for coreference evaluation. Nat. Lang. Eng. 17(4): 485-510 (2011)
2010
[j26]
- view
  authority control:
- export record
  dblp key:
  - journals/ipm/YuWCLH10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ipm/YuWCLH10
Liang-Chih Yu, Chung-Hsien Wu, Ru-Yng Chang, Chao-Hong Liu, Eduard H. Hovy:
Annotation and verification of sense pools in OntoNotes. Inf. Process. Manag. 46(4): 436-447 (2010)
[j25]
- view
  authority control:
- export record
  dblp key:
  - journals/nle/DorrPFGHHHLMMRS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/nle/DorrPFGHHHLMMRS10
Bonnie J. Dorr, Rebecca J. Passonneau, David Farwell, Rebecca Green, Nizar Habash, Stephen Helmreich, Eduard H. Hovy, Lori S. Levin, Keith J. Miller, Teruko Mitamura, Owen Rambow, Advaith Siddharthan:
Interlingual annotation of parallel text corpora: a new framework for annotation and evaluation. Nat. Lang. Eng. 16(3): 197-243 (2010)
[j24]
- view
  authority control:
- export record
  dblp key:
  - journals/polity/ChunSSH10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/polity/ChunSSH10
Soon Ae Chun, Stuart W. Shulman, Rodrigo Sandoval, Eduard H. Hovy:
Government 2.0: Making connections between citizens, data and government. Inf. Polity 15(1-2): 1-9 (2010)
[j23]
- view
  authority control:
- export record
  dblp key:
  - journals/tslp/ZhuWHM10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tslp/ZhuWHM10
Jingbo Zhu, Huizhen Wang, Eduard H. Hovy, Matthew Y. Ma:
Confidence-based stopping criteria for active learning for data annotation. ACM Trans. Speech Lang. Process. 6(3): 3:1-3:24 (2010)
[j22]
- view
  authority control:
- export record
  dblp key:
  - journals/ws/HovyS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ws/HovyS10
Eduard H. Hovy, Susie Stephens:
Introduction to the Special Issue. J. Web Semant. 8(2-3): 143-144 (2010)
2008
[j21]
- view
  - electronic edition @ aclclp.org.tw (open access)
  - no references & citations available
- export record
  dblp key:
  - journals/ijclclp/YuWYH08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ijclclp/YuWYH08
Liang-Chih Yu, Chung-Hsien Wu, Jui-Feng Yeh, Eduard H. Hovy:
Corpus Cleanup of Mistaken Agreement Using Word Sense Disambiguation. Int. J. Comput. Linguistics Chin. Lang. Process. 13(4) (2008)
2007
[j20]
- view
  authority control:
- export record
  dblp key:
  - journals/ijsc/PradhanHMPRW07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ijsc/PradhanHMPRW07
Sameer S. Pradhan, Eduard H. Hovy, Mitchell P. Marcus, Martha Palmer, Lance A. Ramshaw, Ralph M. Weischedel:
Ontonotes: a Unified Relational Semantic Representation. Int. J. Semantic Comput. 1(4): 405-419 (2007)
2006
[j19]
- view
  authority control:
- export record
  dblp key:
  - journals/aim/SwartoutGHHMRT06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/aim/SwartoutGHHMRT06
William R. Swartout, Jonathan Gratch, Randall W. Hill Jr., Eduard H. Hovy, Stacy Marsella, Jeff Rickel, David R. Traum:
Toward Virtual Humans. AI Mag. 27(2): 96-108 (2006)
2005
[j18]
- view
  authority control:
- export record
  dblp key:
  - journals/computer/PantelPH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/computer/PantelPH05
Patrick Pantel, Andrew Philpot, Eduard H. Hovy:
Data Alignment and Integration. Computer 38(12): 43-50 (2005)
[j17]
- view
  authority control:
- export record
  dblp key:
  - journals/jiis/KhanMH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jiis/KhanMH05
Latifur Khan, Dennis McLeod, Eduard H. Hovy:
A Framework for Effective Annotation of Information from Closed Captions Using Ontologies. J. Intell. Inf. Syst. 25(2): 181-205 (2005)
2004
[j16]
- view
  authority control:
- export record
  dblp key:
  - journals/vldb/KhanMH04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/vldb/KhanMH04
Latifur Khan, Dennis McLeod, Eduard H. Hovy:
Retrieval effectiveness of an ontology-based model for information selection. VLDB J. 13(1): 71-85 (2004)
2003
[j15]
- view
  authority control:
- export record
  dblp key:
  - journals/cacm/Hovy03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/cacm/Hovy03
Eduard H. Hovy:
Using an ontology to simplify data access. Commun. ACM 46(1): 47-49 (2003)
[j14]
- view
  authority control:
- export record
  dblp key:
  - journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03
James Allan, Jay Aslam, Nicholas J. Belkin, Chris Buckley, James P. Callan, W. Bruce Croft, Susan T. Dumais, Norbert Fuhr, Donna Harman, David J. Harper, Djoerd Hiemstra, Thomas Hofmann, Eduard H. Hovy, Wessel Kraaij, John D. Lafferty, Victor Lavrenko, David D. Lewis, Liz Liddy, R. Manmatha, Andrew McCallum, Jay M. Ponte, John M. Prager, Dragomir R. Radev, Philip Resnik, Stephen E. Robertson, Ronald Rosenfeld, Salim Roukos, Mark Sanderson, Richard M. Schwartz, Amit Singhal, Alan F. Smeaton, Howard R. Turtle, Ellen M. Voorhees, Ralph M. Weischedel, Jinxi Xu, ChengXiang Zhai:
Challenges in information retrieval and language modeling: report of a workshop held at the center for intelligent information retrieval, University of Massachusetts Amherst, September 2002. SIGIR Forum 37(1): 31-47 (2003)
[j13]
- view
  authority control:
- export record
  dblp key:
  - journals/talip/LeuskiLZGOH03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/talip/LeuskiLZGOH03
Anton Leuski, Chin-Yew Lin, Liang Zhou, Ulrich Germann, Franz Josef Och, Eduard H. Hovy:
Cross-lingual C*ST*RD: English access to Hindi information. ACM Trans. Asian Lang. Inf. Process. 2(3): 245-269 (2003)
2002
[j12]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/coling/RadevHM02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/coling/RadevHM02
Dragomir R. Radev, Eduard H. Hovy, Kathleen R. McKeown:
Introduction to the Special Issue on Summarization. Comput. Linguistics 28(4): 399-408 (2002)
[j11]
- view
  authority control:
- export record
  dblp key:
  - journals/mt/HovyKP02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/mt/HovyKP02
Eduard H. Hovy, Margaret King, Andrei Popescu-Belis:
Principles of Context-Based Machine Translation Evaluation. Mach. Transl. 17(1): 43-75 (2002)
2001
[j10]
- view
  authority control:
- export record
  dblp key:
  - journals/computer/AmbiteAHPGHK01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/computer/AmbiteAHPGHK01
José Luis Ambite, Yigal Arens, Eduard H. Hovy, Andrew Philpot, Luis Gravano, Vasileios Hatzivassiloglou, Judith Klavans:
Simplifying Data Access: The Energy Data Collection Project. Computer 34(2): 47-54 (2001)
[j9]
- view
  authority control:
- export record
  dblp key:
  - journals/lre/FrederkingHI01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/lre/FrederkingHI01
Robert E. Frederking, Eduard H. Hovy, Nancy Ide:
Introduction to the Special Issue on Multi-Lingual Information Management. Comput. Humanit. 35(4): 369-370 (2001)
1999
[j8]
- view
  authority control:
- export record
  dblp key:
  - journals/aim/GreenCKSCRHHHFOS99
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/aim/GreenCKSCRHHHFOS99
Nancy L. Green, Jennifer Chu-Carroll, David Kortenkamp, Alan C. Schultz, Michael H. Coen, Dragomir R. Radev, Eduard H. Hovy, Peter Haddawy, Steve Hanks, Eugene C. Freuder, Charlie Ortiz, Sandip Sen:
The AAAI Spring Symposia. AI Mag. 20(3): 83-86 (1999)
1995
[j7]
- view
  authority control:
- export record
  dblp key:
  - journals/aim/SmedtHMM95
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/aim/SmedtHMM95
Koenraad De Smedt, Eduard H. Hovy, David D. McDonald, Marie Meteer:
The Seventh International Workshop on Natural Language Generation. AI Mag. 16(3): 67-68 (1995)
[j6]
- view
  authority control:
- export record
  dblp key:
  - journals/air/ArensH95
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/air/ArensH95
Yigal Arens, Eduard H. Hovy:
The Design of a Model-Based Multimedia Interaction Manager. Artif. Intell. Rev. 9(2-3): 167-188 (1995)
1993
[j5]
- view
  authority control:
- export record
  dblp key:
  - journals/ai/Hovy93
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ai/Hovy93
Eduard H. Hovy:
Automated Discourse Generation Using Discourse Structure Relations. Artif. Intell. 63(1-2): 341-385 (1993)
[j4]
- view
  authority control:
- export record
  dblp key:
  - journals/mt/ChurchH93
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/mt/ChurchH93
Kenneth Ward Church, Eduard H. Hovy:
Good applications for crummy machine translation. Mach. Transl. 8(4): 239-258 (1993)
1992
[j3]
- view
  authority control:
- export record
  dblp key:
  - journals/expert/Hovy92
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/expert/Hovy92
Eduard H. Hovy:
A New Level of Language Generation Technology: Capabilities and Possibilities. IEEE Expert 7(2): 12-17 (1992)
1990
[j2]
- view
  authority control:
- export record
  dblp key:
  - journals/ai/Hovy90
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ai/Hovy90
Eduard H. Hovy:
Pragmatics and Natural Language Generation. Artif. Intell. 43(2): 153-197 (1990)
1989
[j1]
- view
  authority control:
- export record
  dblp key:
  - journals/aim/HovyMY89
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/aim/HovyMY89
Eduard H. Hovy, David D. McDonald, Sheryl R. Young:
Current Issues in Natural Language Generation: An Overview of the AAAI Workshop on Text Planning and Realization. AI Mag. 10(3): 27-29 (1989)

Conference and Workshop Papers

see FAQ

What is the meaning of the colors in the publication lists?

2023
[c358]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/WenXHH23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/WenXHH23
Haoyang Wen, Zhenxin Xiao, Eduard H. Hovy, Alexander G. Hauptmann:
Towards Open-Domain Twitter User Profile Inference. ACL (Findings) 2023: 3172-3188
[c357]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/OtaniAKH23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/OtaniAKH23
Naoki Otani, Jun Araki, HyeongSik Kim, Eduard H. Hovy:
A Textual Dataset for Situated Proactive Response Selection. ACL (1) 2023: 3856-3874
[c356]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/TedeschiBDHHHKK23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/TedeschiBDHHHKK23
Simone Tedeschi, Johan Bos, Thierry Declerck, Jan Hajic, Daniel Hershcovich, Eduard H. Hovy, Alexander Koller, Simon Krek, Steven Schockaert, Rico Sennrich, Ekaterina Shutova, Roberto Navigli:
What's the Meaning of Superhuman Performance in Today's NLU? ACL (1) 2023: 12471-12491
[c355]
- view
  authority control:
- export record
  dblp key:
  - conf/eacl/FengKSGH23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/eacl/FengKSGH23
Steven Y. Feng, Vivek Khetan, Bogdan Sacaleanu, Anatole Gershman, Eduard H. Hovy:
CHARD: Clinical Health-Aware Reasoning Across Dimensions for Text Generation Models. EACL 2023: 313-327
[c354]
- view
  authority control:
- export record
  dblp key:
  - conf/eacl/KehFGAH23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/eacl/KehFGAH23
Sedrick Scott Keh, Steven Y. Feng, Varun Gangal, Malihe Alikhani, Eduard H. Hovy:
PANCETTA: Phoneme Aware Neural Completion to Elicit Tongue Twisters Automatically. EACL 2023: 491-504
[c353]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/LiHL23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/LiHL23
Miao Li, Eduard H. Hovy, Jey Han Lau:
Summarizing Multiple Documents with Conversational Structure for Meta-Review Generation. EMNLP (Findings) 2023: 7089-7112
[c352]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/LiHYEL00YTHJ23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/LiHYEL00YTHJ23
Sha Li, Chi Han, Pengfei Yu, Carl Edwards, Manling Li, Xingyao Wang, Yi Ren Fung, Charles Yu, Joel R. Tetreault, Eduard H. Hovy, Heng Ji:
Defining a New NLP Playground. EMNLP (Findings) 2023: 11932-11951
[c351]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/ZhangSH23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/ZhangSH23
Zhisong Zhang, Emma Strubell, Eduard H. Hovy:
Data-efficient Active Learning for Structured Prediction with Partial Annotation and Self-Training. EMNLP (Findings) 2023: 12991-13008
[c350]
- view
  authority control:
- export record
  dblp key:
  - conf/ijcnlp/RajagopalKSGFH23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcnlp/RajagopalKSGFH23
Dheeraj Rajagopal, Vivek Khetan, Bogdan Sacaleanu, Anatole Gershman, Andrew E. Fano, Eduard H. Hovy:
Template Filling for Controllable Commonsense Reasoning. IJCNLP (Findings) 2023: 250-260
[c349]
- view
  authority control:
- export record
  dblp key:
  - conf/sustainlp/ZhangSH23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sustainlp/ZhangSH23
Zhisong Zhang, Emma Strubell, Eduard H. Hovy:
On the Interactions of Structural Constraints and Data Resources for Structured Prediction. SustaiNLP 2023: 147-157
2022
[c348]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/aaai/FengLTAMHG22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/FengLTAMHG22
Steven Y. Feng, Kevin Lu, Zhuofu Tao, Malihe Alikhani, Teruko Mitamura, Eduard H. Hovy, Varun Gangal:
Retrieve, Caption, Generate: Visual Grounding for Enhancing Commonsense in Text Generation Models. AAAI 2022: 10618-10626
[c347]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/aaai/GangalFAMH22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/GangalFAMH22
Varun Gangal, Steven Y. Feng, Malihe Alikhani, Teruko Mitamura, Eduard H. Hovy:
NAREOR: The Narrative Reordering Problem. AAAI 2022: 10645-10653
[c346]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/KehLGFJAH22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/KehLGFJAH22
Sedrick Scott Keh, Kevin Lu, Varun Gangal, Steven Y. Feng, Harsh Jhamtani, Malihe Alikhani, Eduard H. Hovy:
PINEAPPLE: Personifying INanimate Entities by Acquiring Parallel Personification Data for Learning Enhanced Generation. COLING 2022: 6270-6284
[c345]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/SpiliopoulouPBH22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/SpiliopoulouPBH22
Evangelia Spiliopoulou, Artidoro Pagnoni, Yonatan Bisk, Eduard H. Hovy:
EvEntS ReaLM: Event Reasoning of Entity States via Language Models. EMNLP 2022: 1982-1997
[c344]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/ZhangSH22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/ZhangSH22
Zhisong Zhang, Emma Strubell, Eduard H. Hovy:
Transfer Learning from Semantic Role Labeling to Event Argument Extraction with Template-based Slot Querying. EMNLP 2022: 2627-2647
[c343]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/ReddyCWFCEPNHSJ22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/ReddyCWFCEPNHSJ22
Revanth Gangi Reddy, Sai Chetan Chinthakindi, Zhenhailong Wang, Yi R. Fung, Kathryn Conger, Ahmed Elsayed, Martha Palmer, Preslav Nakov, Eduard H. Hovy, Kevin Small, Heng Ji:
NewsClaims: A New Benchmark for Claim Detection from News with Attribute Knowledge. EMNLP 2022: 6002-6018
[c342]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/ZhangSH22a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/ZhangSH22a
Zhisong Zhang, Emma Strubell, Eduard H. Hovy:
A Survey of Active Learning for Natural Language Processing. EMNLP 2022: 6166-6190
[c341]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/lrec/RajagopalZGJYH22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/RajagopalZGJYH22
Dheeraj Rajagopal, Xuchao Zhang, Michael Gamon, Sujay Kumar Jauhar, Diyi Yang, Eduard H. Hovy:
One Document, Many Revisions: A Dataset for Classification and Description of Edit Intents. LREC 2022: 5517-5524
[c340]
- view
  authority control:
- export record
  dblp key:
  - conf/tsd/Echizen-yaAH22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tsd/Echizen-yaAH22
Hiroshi Echizen-ya, Kenji Araki, Eduard H. Hovy:
OPTICS: Automatic MT Evaluation Based on Optimal Transport by Integration of Contextual Representations and Static Word Embeddings. TSD 2022: 225-237
2021
[c339]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/FengGWCVMH21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/FengGWCVMH21
Steven Y. Feng, Varun Gangal, Jason Wei, Sarath Chandar, Soroush Vosoughi, Teruko Mitamura, Eduard H. Hovy:
A Survey of Data Augmentation Approaches for NLP. ACL/IJCNLP (Findings) 2021: 968-988
[c338]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/BhardwajMPH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/BhardwajMPH20
Rishabh Bhardwaj, Navonil Majumder, Soujanya Poria, Eduard H. Hovy:
More Identifiable yet Equally Performant Transformers for Text Classification. ACL/IJCNLP (1) 2021: 1172-1182
[c337]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/KangH20a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/KangH20a
Dongyeop Kang, Eduard H. Hovy:
Style is NOT a single variable: Case Studies for Cross-Stylistic Language Understanding. ACL/IJCNLP (1) 2021: 2376-2387
[c336]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/GangalJHB21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/GangalJHB21
Varun Gangal, Harsh Jhamtani, Eduard H. Hovy, Taylor Berg-Kirkpatrick:
Improving Automated Evaluation of Open Domain Dialog via Diverse Reference Augmentation. ACL/IJCNLP (Findings) 2021: 4079-4090
[c335]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/MadaanRTYH21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/MadaanRTYH21
Aman Madaan, Dheeraj Rajagopal, Niket Tandon, Yiming Yang, Eduard H. Hovy:
Could you give me a hint ? Generating inference graphs for defeasible reasoning. ACL/IJCNLP (Findings) 2021: 5138-5147
[c334]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/LiCFMWH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/LiCFMWH20
Ruifan Li, Hao Chen, Fangxiang Feng, Zhanyu Ma, Xiaojie Wang, Eduard H. Hovy:
Dual Graph Convolutional Networks for Aspect-based Sentiment Analysis. ACL/IJCNLP (1) 2021: 6319-6329
[c333]
- view
  authority control:
- export record
  dblp key:
  - conf/acl-spnlp/ZhangSH21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl-spnlp/ZhangSH21
Zhisong Zhang, Emma Strubell, Eduard H. Hovy:
Comparing Span Extraction Methods for Semantic Role Labeling. SPNLP@ACL-IJCNLP 2021: 67-77
[c332]
- view
  authority control:
- export record
  dblp key:
  - conf/eacl/RavichanderDRMH21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/eacl/RavichanderDRMH21
Abhilasha Ravichander, Siddharth Dalmia, Maria Ryskina, Florian Metze, Eduard H. Hovy, Alan W. Black:
NoiseQA: Challenge Set Evaluation for User-Centric Question Answering. EACL 2021: 2976-2992
[c331]
- view
  authority control:
- export record
  dblp key:
  - conf/eacl/RavichanderBH21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/eacl/RavichanderBH21
Abhilasha Ravichander, Yonatan Belinkov, Eduard H. Hovy:
Probing the Probing Paradigm: Does Probing Accuracy Entail Task Relevance? EACL 2021: 3363-3377
[c330]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/RajagopalBHT21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/RajagopalBHT21
Dheeraj Rajagopal, Vidhisha Balachandran, Eduard H. Hovy, Yulia Tsvetkov:
SELFEXPLAIN: A Self-Explaining Architecture for Neural Text Classifiers. EMNLP (1) 2021: 836-850
[c329]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/JoYBORH21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/JoYBORH21
Yohan Jo, Haneul Yoo, JinYeong Bak, Alice Oh, Chris Reed, Eduard H. Hovy:
Knowledge-Enhanced Evidence Retrieval for Counterargument Generation. EMNLP (Findings) 2021: 3074-3094
[c328]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/ZhangSH21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/ZhangSH21
Zhisong Zhang, Emma Strubell, Eduard H. Hovy:
On the Benefit of Syntactic Supervision for Cross-lingual Transfer in Semantic Role Labeling. EMNLP (1) 2021: 6229-6246
[c327]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/MadaanTRCYH21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/MadaanTRCYH21
Aman Madaan, Niket Tandon, Dheeraj Rajagopal, Peter Clark, Yiming Yang, Eduard H. Hovy:
Think about it! Improving defeasible reasoning by first modeling the question scenario. EMNLP (1) 2021: 6291-6310
[c326]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/JhamtaniGHB21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/JhamtaniGHB21
Harsh Jhamtani, Varun Gangal, Eduard H. Hovy, Taylor Berg-Kirkpatrick:
Investigating Robustness of Dialog Models to Popular Figurative Language Constructs. EMNLP (1) 2021: 7476-7485
[c325]
- view
  - electronic edition @ openreview.net (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/iclr/KaushikSHL21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iclr/KaushikSHL21
Divyansh Kaushik, Amrith Setlur, Eduard H. Hovy, Zachary Chase Lipton:
Explaining the Efficacy of Counterfactually Augmented Data. ICLR 2021
[c324]
- view
  - electronic edition @ openreview.net (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/iclr/MaKZH21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iclr/MaKZH21
Xuezhe Ma, Xiang Kong, Shanghang Zhang, Eduard H. Hovy:
Decoupling Global and Local Representations via Invertible Generative Flows. ICLR 2021
[c323]
- view
  authority control:
- export record
  dblp key:
  - conf/inlg/FengHNHG21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/inlg/FengHNHG21
Steven Y. Feng, Jessica Huynh, Chaitanya Prasad Narisetty, Eduard H. Hovy, Varun Gangal:
SAPPHIRE: Approaches for Enhanced Concept-to-Text Generation. INLG 2021: 212-225
[c322]
- view
  authority control:
- export record
  dblp key:
  - conf/naacl/LyuLPHPSM21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/LyuLPHPSM21
Yiwei Lyu, Paul Pu Liang, Hai Pham, Eduard H. Hovy, Barnabás Póczos, Ruslan Salakhutdinov, Louis-Philippe Morency:
StylePTB: A Compositional Benchmark for Fine-grained Controllable Text Style Transfer. NAACL-HLT 2021: 2116-2138
2020
[c321]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/ZongRH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/ZongRH20
Shi Zong, Alan Ritter, Eduard H. Hovy:
Measuring Forecasting Skill from Text. ACL 2020: 5317-5331
[c320]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/KongGH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/KongGH20
Xiang Kong, Varun Gangal, Eduard H. Hovy:
SCDE: Sentence Cloze Dataset with High Quality Distractors From Examinations. ACL 2020: 5668-5683
[c319]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/ZhangKLMH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/ZhangKLMH20
Zhisong Zhang, Xiang Kong, Zhengzhong Liu, Xuezhe Ma, Eduard H. Hovy:
A Two-Step Approach for Implicit Event Argument Detection. ACL 2020: 7479-7485
[c318]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/blackboxnlp/GangalH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/blackboxnlp/GangalH20
Varun Gangal, Eduard H. Hovy:
BERTering RAMS: What and How Much does BERT Already Know About Event Arguments? - A Study on the RAMS Dataset. BlackboxNLP@EMNLP 2020: 1-10
[c317]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/blackboxnlp/RungeH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/blackboxnlp/RungeH20
Andrew Runge, Eduard H. Hovy:
Exploring Neural Entity Representations for Semantic Information. BlackboxNLP@EMNLP 2020: 204-216
[c316]
- view
  authority control:
- export record
  dblp key:
  - conf/coling/SpiliopoulouPH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/SpiliopoulouPH20
Evangelia Spiliopoulou, Artidoro Pagnoni, Eduard H. Hovy:
Definition Frames: Using Definitions for Hybrid Concept Representations. COLING 2020: 3060-3068
[c315]
- view
  authority control:
- export record
  dblp key:
  - conf/cvpr/XieLHL20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cvpr/XieLHL20
Qizhe Xie, Minh-Thang Luong, Eduard H. Hovy, Quoc V. Le:
Self-Training With Noisy Student Improves ImageNet Classification. CVPR 2020: 10684-10695
[c314]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/emnlp/ChandrasekaranF20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/ChandrasekaranF20
Muthu Kumar Chandrasekaran, Guy Feigenblat, Dayne Freitag, Tirthankar Ghosal, Eduard H. Hovy, Philipp Mayr, Michal Shmueli-Scheuer, Anita de Waard:
Overview of the First Workshop on Scholarly Document Processing (SDP). SDP@EMNLP 2020: 1-6
[c313]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/JoBMHR20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/JoBMHR20
Yohan Jo, Seojin Bang, Emaad A. Manzoor, Eduard H. Hovy, Chris Reed:
Detecting Attackable Sentences in Arguments. EMNLP (1) 2020: 1-23
[c312]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/JoVRH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/JoVRH20
Yohan Jo, Jacky Visser, Chris Reed, Eduard H. Hovy:
Extracting Implicitly Asserted Propositions in Argumentation. EMNLP (1) 2020: 24-38
[c311]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/emnlp/ChandrasekaranF20a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/ChandrasekaranF20a
Muthu Kumar Chandrasekaran, Guy Feigenblat, Eduard H. Hovy, Abhilasha Ravichander, Michal Shmueli-Scheuer, Anita de Waard:
Overview and Insights from the Shared Tasks at Scholarly Document Processing 2020: CL-SciSumm, LaySumm and LongSumm. SDP@EMNLP 2020: 214-224
[c310]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/KongZH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/KongZH20
Xiang Kong, Zhisong Zhang, Eduard H. Hovy:
Incorporating a Local Translation Mechanism into Non-autoregressive Translation. EMNLP (1) 2020: 1067-1073
[c309]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/ZhangKLH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/ZhangKLH20
Zhisong Zhang, Xiang Kong, Lori S. Levin, Eduard H. Hovy:
An Empirical Exploration of Local Ordering Pre-training for Structured Learning. EMNLP (Findings) 2020: 1770-1783
[c308]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/RajagopalTCDH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/RajagopalTCDH20
Dheeraj Rajagopal, Niket Tandon, Peter Clark, Bhavana Dalvi, Eduard H. Hovy:
What-if I ask you to explain: Explaining the effects of perturbations in procedural text. EMNLP (Findings) 2020: 3345-3355
[c307]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/MazaSHH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/MazaSHH20
Salvador Medina Maza, Evangelia Spiliopoulou, Eduard H. Hovy, Alexander G. Hauptmann:
Event-Related Bias Removal for Real-time Disaster Events. EMNLP (Findings) 2020: 3858-3868
[c306]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/TandonSDRCGRH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/TandonSDRCGRH20
Niket Tandon, Keisuke Sakaguchi, Bhavana Dalvi, Dheeraj Rajagopal, Peter Clark, Michal Guerquin, Kyle Richardson, Eduard H. Hovy:
A Dataset for Tracking Entities in Open Domain Procedural Text. EMNLP (1) 2020: 6408-6417
[c305]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/KangH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/KangH20
Dongyeop Kang, Eduard H. Hovy:
Plan ahead: Self-Supervised Text Planning for Paragraph Completion Task. EMNLP (1) 2020: 6533-6543
[c304]
- view
  - electronic edition @ openreview.net (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/iclr/KaushikHL20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iclr/KaushikHL20
Divyansh Kaushik, Eduard H. Hovy, Zachary Chase Lipton:
Learning The Difference That Makes A Difference With Counterfactually-Augmented Data. ICLR 2020
[c303]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/lrec/JoMRH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/JoMRH20
Yohan Jo, Elijah Mayfield, Chris Reed, Eduard H. Hovy:
Machine-Aided Annotation for Fine-Grained Proposition Types in Argumentation. LREC 2020: 1008-1018
[c302]
- view
  authority control:
- export record
  dblp key:
  - conf/mir/0001CHH20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mir/0001CHH20
Po-Yao Huang, Xiaojun Chang, Alexander G. Hauptmann, Eduard H. Hovy:
Forward and Backward Multimodal NMT for Improved Monolingual and Multilingual Cross-Modal Retrieval. ICMR 2020: 53-62
[c301]
- view
  - electronic edition @ neurips.cc (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/nips/XieDHL020
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/nips/XieDHL020
Qizhe Xie, Zihang Dai, Eduard H. Hovy, Thang Luong, Quoc Le:
Unsupervised Data Augmentation for Consistency Training. NeurIPS 2020
[c300]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/starsem/RavichanderHSTC20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/starsem/RavichanderHSTC20
Abhilasha Ravichander, Eduard H. Hovy, Kaheer Suleman, Adam Trischler, Jackie Chi Kit Cheung:
On the Systematicity of Probing Contextualized Word Representations: The Case of Hypernymy in BERT. *SEM@COLING 2020: 88-102
2019
[c299]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/aaai/KongTSHZ19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/KongTSHZ19
Xiang Kong, Zhaopeng Tu, Shuming Shi, Eduard H. Hovy, Tong Zhang:
Neural Machine Translation with Adequacy-Oriented Learning. AAAI 2019: 6618-6625
[c298]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/aaai/KongXDH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/KongXDH19
Xiang Kong, Qizhe Xie, Zihang Dai, Eduard H. Hovy:
Fast and Simple Mixture of Softmaxes with BPE and Hybrid-LightRNN for Language Generation. AAAI 2019: 6626-6633
[c297]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/NaikRRH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/NaikRRH19
Aakanksha Naik, Abhilasha Ravichander, Carolyn P. Rosé, Eduard H. Hovy:
Exploring Numeracy in Word Embeddings. ACL (1) 2019: 3374-3380
[c296]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/GarimellaBHM19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/GarimellaBHM19
Aparna Garimella, Carmen Banea, Eduard H. Hovy, Rada Mihalcea:
Women's Syntactic Resilience and Men's Grammatical Luck: Gender-Bias in Part-of-Speech Tagging and Dependency Parsing. ACL (1) 2019: 3493-3498
[c295]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/OtaniH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/OtaniH19
Naoki Otani, Eduard H. Hovy:
Toward Comprehensive Understanding of a Sentiment Based on Human Motives. ACL (1) 2019: 4672-4677
[c294]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/ZhangMH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/ZhangMH19
Zhisong Zhang, Xuezhe Ma, Eduard H. Hovy:
An Empirical Investigation of Structured Output Modeling for Graph-based Neural Dependency Parsing. ACL (1) 2019: 5592-5598
[c293]
- view
  authority control:
- export record
  dblp key:
  - conf/argmining/JoVRH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/argmining/JoVRH19
Yohan Jo, Jacky Visser, Chris Reed, Eduard H. Hovy:
A Cascade Model for Proposition Extraction in Argumentation. ArgMining@ACL 2019: 11-24
[c292]
- view
  authority control:
- export record
  dblp key:
  - conf/bionlp/RajagopalVSRTH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bionlp/RajagopalVSRTH19
Dheeraj Rajagopal, Nidhi Vyas, Aditya Siddhant, Anirudha Rayasam, Niket Tandon, Eduard H. Hovy:
Domain Adaptation of SRL Systems for Biological Processes. BioNLP@ACL 2019: 80-87
[c291]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/conll/RavichanderNRH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/conll/RavichanderNRH19
Abhilasha Ravichander, Aakanksha Naik, Carolyn P. Rosé, Eduard H. Hovy:
EQUATE: A Benchmark Evaluation Framework for Quantitative Reasoning in Natural Language Inference. CoNLL 2019: 349-361
[c290]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/emnlp/KangGH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/KangGH19
Dongyeop Kang, Varun Gangal, Eduard H. Hovy:
(Male, Bachelor) and (Female, Ph.D) have different connotations: Parallelly Annotated Stylistic Language Dataset with Multiple Personas. EMNLP/IJCNLP (1) 2019: 1696-1706
[c289]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/emnlp/JungKMH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/JungKMH19
Taehee Jung, Dongyeop Kang, Lucas Mentch, Eduard H. Hovy:
Earlier Isn't Always Better: Sub-aspect Analysis on Corpus and System Biases in Summarization. EMNLP/IJCNLP (1) 2019: 3322-3333
[c288]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/emnlp/MaZLNH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/MaZLNH19
Xuezhe Ma, Chunting Zhou, Xian Li, Graham Neubig, Eduard H. Hovy:
FlowSeq: Non-Autoregressive Conditional Sequence Generation with Generative Flow. EMNLP/IJCNLP (1) 2019: 4281-4291
[c287]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/emnlp/KangH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/KangH19
Dongyeop Kang, Eduard H. Hovy:
Linguistic Versus Latent Relations for Modeling Coherent Flow in Paragraphs. EMNLP/IJCNLP (1) 2019: 5808-5814
[c286]
- view
  authority control:
- export record
  dblp key:
  - conf/icassp/VyasRMHB19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icassp/VyasRMHB19
Nidhi Vyas, Sai Krishna Rallabandi, Lalitesh Morishetti, Eduard H. Hovy, Alan W. Black:
Learning Disentangled Representation in Latent Stochastic Models: A Case Study with Image Captioning. ICASSP 2019: 4010-4014
[c285]
- view
  - electronic edition @ openreview.net (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/iclr/MaZH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iclr/MaZH19
Xuezhe Ma, Chunting Zhou, Eduard H. Hovy:
MAE: Mutual Posterior-Divergence Regularization for Variational AutoEncoders. ICLR (Poster) 2019
[c284]
- view
  authority control:
- export record
  dblp key:
  - conf/naacl/Echizen-yaAH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/Echizen-yaAH19
Hiroshi Echizen-ya, Kenji Araki, Eduard H. Hovy:
Word Embedding-Based Automatic MT Evaluation Metric using Word Position Information. NAACL-HLT (1) 2019: 1874-1883
[c283]
- view
  authority control:
- export record
  dblp key:
  - conf/naacl/AhmadZMHCP19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/AhmadZMHCP19
Wasi Uddin Ahmad, Zhisong Zhang, Xuezhe Ma, Eduard H. Hovy, Kai-Wei Chang, Nanyun Peng:
On Difficulties of Cross-Lingual Transfer with Order Differences: A Case Study on Dependency Parsing. NAACL-HLT (1) 2019: 2440-2452
[c282]
- view
  authority control:
- export record
  dblp key:
  - conf/naacl/Dasigi0MZH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/Dasigi0MZH19
Pradeep Dasigi, Matt Gardner, Shikhar Murty, Luke Zettlemoyer, Eduard H. Hovy:
Iterative Search for Weakly Supervised Semantic Parsing. NAACL-HLT (1) 2019: 2669-2680
[c281]
- view
  authority control:
- export record
  dblp key:
  - conf/naacl/YangCYJH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/YangCYJH19
Diyi Yang, Jiaao Chen, Zichao Yang, Dan Jurafsky, Eduard H. Hovy:
Let's Make Your Request More Persuasive: Modeling Persuasive Strategies via Semi-Supervised Neural Nets on Crowdfunding Platforms. NAACL-HLT (1) 2019: 3620-3630
[c280]
- view
- export record
  dblp key:
  - conf/nips/MaKZH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/nips/MaKZH19
Xuezhe Ma, Xiang Kong, Shanghang Zhang, Eduard H. Hovy:
MaCow: Masked Convolutional Generative Flow. NeurIPS 2019: 5891-5900
[c279]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/textgraphs/VaibhavAH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/textgraphs/VaibhavAH19
Vaibhav Vaibhav, Raghuram Mandyam Annasamy, Eduard H. Hovy:
Do Sentence Interactions Matter? Leveraging Sentence Level Representations for Fake News Classification. TextGraphs@EMNLP 2019: 134-139
2018
[c278]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/aaai/SubramanianPJBH18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/SubramanianPJBH18
Anant Subramanian, Danish Pruthi, Harsh Jhamtani, Taylor Berg-Kirkpatrick, Eduard H. Hovy:
SPINE: SParse Interpretable Neural Embeddings. AAAI 2018: 4921-4928
[c277]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/HovyMNPHL18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/HovyMNPHL18
Xuezhe Ma, Zecong Hu, Jingzhou Liu, Nanyun Peng, Graham Neubig, Eduard H. Hovy:
Stack-Pointer Networks for Dependency Parsing. ACL (1) 2018: 1403-1414
[c276]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/HovyNBGJ18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/HovyNBGJ18
Harsh Jhamtani, Varun Gangal, Eduard H. Hovy, Graham Neubig, Taylor Berg-Kirkpatrick:
Learning to Generate Move-by-Move Commentary for Chess Games from Large-Scale Social Forum Data. ACL (1) 2018: 1661-1671
[c275]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/HovyXD18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/HovyXD18
Zihang Dai, Qizhe Xie, Eduard H. Hovy:
From Credit Assignment to Entropy Regularization: Two New Algorithms for Neural Sequence Prediction. ACL (1) 2018: 1672-1682
[c274]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/HovyKSK18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/HovyKSK18
Dongyeop Kang, Tushar Khot, Ashish Sabharwal, Eduard H. Hovy:
AdvEntuRe: Adversarial Training for Textual Entailment with Knowledge-Guided Examples. ACL (1) 2018: 2418-2428
[c273]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/MuisOVXYMH18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/MuisOVXYMH18
Aldrian Obaja Muis, Naoki Otani, Nidhi Vyas, Ruochen Xu, Yiming Yang, Teruko Mitamura, Eduard H. Hovy:
Low-resource Cross-lingual Event Type Detection via Distant Supervision with Minimal Effort. COLING 2018: 70-82
[c272]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/LiuMH18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/LiuMH18
Zhengzhong Liu, Teruko Mitamura, Eduard H. Hovy:
Graph Based Decoding for Event Sequencing and Coreference Resolution. COLING 2018: 3645-3657
[c271]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/LiuXMH18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/LiuXMH18
Zhengzhong Liu, Chenyan Xiong, Teruko Mitamura, Eduard H. Hovy:
Automatic Event Salience Identification. EMNLP 2018: 1226-1236
[c270]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/XieLDH18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/XieLDH18
Qizhe Xie, Guokun Lai, Zihang Dai, Eduard H. Hovy:
Large-scale Cloze Test Dataset Created by Teachers. EMNLP 2018: 2344-2356
[c269]
- no documents available
  - no references & citations available
- export record
  dblp key:
  - conf/icaart/Hovy18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icaart/Hovy18
Eduard H. Hovy:
Reading Agents that Hunger for Knowledge. ICAART (1) 2018: 9
[c268]
- view
  authority control:
- export record
  dblp key:
  - conf/naacl/KangADZKHS18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/KangADZKHS18
Dongyeop Kang, Waleed Ammar, Bhavana Dalvi, Madeleine van Zuylen, Sebastian Kohlmeier, Eduard H. Hovy, Roy Schwartz:
A Dataset of Peer Reviews (PeerRead): Collection, Insights and NLP Applications. NAACL-HLT 2018: 1647-1661
2017
[c267]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/SpiliopoulouHM17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/SpiliopoulouHM17
Evangelia Spiliopoulou, Eduard H. Hovy, Teruko Mitamura:
Event Detection Using Frame-Semantic Parser. NEWS@ACL 2017: 15-20
[c266]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/acl/XieMDH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/XieMDH17
Qizhe Xie, Xuezhe Ma, Zihang Dai, Eduard H. Hovy:
An Interpretable Knowledge Transfer Model for Knowledge Base Completion. ACL (1) 2017: 950-962
[c265]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/acl/DasigiADH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/DasigiADH17
Pradeep Dasigi, Waleed Ammar, Chris Dyer, Eduard H. Hovy:
Ontology-Aware Token Embeddings for Prepositional Phrase Attachment. ACL (1) 2017: 2089-2098
[c264]
- view
  authority control:
- export record
  dblp key:
  - conf/aclnut/SalehiHHS17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aclnut/SalehiHHS17
Bahar Salehi, Dirk Hovy, Eduard H. Hovy, Anders Søgaard:
Huntsville, hospitals, and hockey teams: Names can reveal your location. NUT@EMNLP 2017: 116-121
[c263]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/XiongLCH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/XiongLCH17
Chenyan Xiong, Zhengzhong Liu, Jamie Callan, Eduard H. Hovy:
JointSem: Combining Query Entity Linking and Entity based Document Ranking. CIKM 2017: 2391-2394
[c262]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/LaiXLYH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/LaiXLYH17
Guokun Lai, Qizhe Xie, Hanxiao Liu, Yiming Yang, Eduard H. Hovy:
RACE: Large-scale ReAding Comprehension Dataset From Examinations. EMNLP 2017: 785-794
[c261]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/YangHKH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/YangHKH17
Diyi Yang, Aaron Halfaker, Robert E. Kraut, Eduard H. Hovy:
Identifying Semantic Edit Intentions from Revisions in Wikipedia. EMNLP 2017: 2000-2010
[c260]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/KangGLCH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/KangGLCH17
Dongyeop Kang, Varun Gangal, Ang Lu, Zheng Chen, Eduard H. Hovy:
Detecting and Explaining Causes From Text For a Time Series Event. EMNLP 2017: 2758-2767
[c259]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/GangalJNHN17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/GangalJNHN17
Varun Gangal, Harsh Jhamtani, Graham Neubig, Eduard H. Hovy, Eric Nyberg:
Charmanteau: Character Embedding Models For Portmanteau Creation. EMNLP 2017: 2917-2922
[c258]
- view
  - electronic edition @ openreview.net (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/iclr/DaiABHC17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iclr/DaiABHC17
Zihang Dai, Amjad Almahairi, Philip Bachman, Eduard H. Hovy, Aaron C. Courville:
Calibrating Energy-based Generative Adversarial Networks. ICLR (Poster) 2017
[c257]
- view
  - electronic edition @ openreview.net (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/iclr/MaGHYDH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iclr/MaGHYDH17
Xuezhe Ma, Yingkai Gao, Zhiting Hu, Yaoliang Yu, Yuntian Deng, Eduard H. Hovy:
Dropout with Expectation-linear Regularization. ICLR (Poster) 2017
[c256]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/ijcnlp/MaH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcnlp/MaH17
Xuezhe Ma, Eduard H. Hovy:
Neural Probabilistic Model for Non-projective MST Parsing. IJCNLP(1) 2017: 59-69
[c255]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/ijcnlp/XuMTH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcnlp/XuMTH17
Jiarui Xu, Xuezhe Ma, Chen-Tse Tsai, Eduard H. Hovy:
STCP: Simplified-Traditional Chinese Conversion and Proofreading. IJCNLP (System Demonstrations) 2017: 61-64
[c254]
- view
  - electronic edition @ ceur-ws.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/mediaeval/SutcliffeMH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mediaeval/SutcliffeMH17
Richard F. E. Sutcliffe, Donncha Ó Maidín, Eduard H. Hovy:
The C@merata task at MediaEval 2017: Natural Language Queries about Music, their JSON Representations, and Matching Passages in MusicXML Scores. MediaEval 2017
[c253]
- view
- export record
  dblp key:
  - conf/nips/XieDDHN17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/nips/XieDDHN17
Qizhe Xie, Zihang Dai, Yulun Du, Eduard H. Hovy, Graham Neubig:
Controllable Invariance through Adversarial Feature Learning. NIPS 2017: 585-596
[c252]
- view
  - electronic edition @ ceur-ws.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/semweb/BurnsDH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/semweb/BurnsDH17
Gully Burns, Pradeep Dasigi, Eduard H. Hovy:
Extracting Evidence Fragments for Distant Supervision of Molecular Interactions. SemSci@ISWC 2017: 7-14
[c251]
- view
  authority control:
- export record
  dblp key:
  - conf/sigdial/JangMHR17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigdial/JangMHR17
Hyeju Jang, Keith Maki, Eduard H. Hovy, Carolyn P. Rosé:
Finding Structure in Figurative Language: Metaphor Detection with Topic-based Frames. SIGDIAL Conference 2017: 320-330
[c250]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/starsem/JauharH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/starsem/JauharH17
Sujay Kumar Jauhar, Eduard H. Hovy:
Embedded Semantic Lexicon Induction with Joint Global and Local Optimization. *SEM 2017: 209-219
2016
[c249]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/HuMLHX16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/HuMLHX16
Zhiting Hu, Xuezhe Ma, Zhengzhong Liu, Eduard H. Hovy, Eric P. Xing:
Harnessing Deep Neural Networks with Logic Rules. ACL (1) 2016
[c248]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/JauharTH16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/JauharTH16
Sujay Kumar Jauhar, Peter D. Turney, Eduard H. Hovy:
Tables as Semi-structured Knowledge for Question Answering. ACL (1) 2016
[c247]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/MaH16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/MaH16
Xuezhe Ma, Eduard H. Hovy:
End-to-end Sequence Labeling via Bi-directional LSTM-CNNs-CRF. ACL (1) 2016
[c246]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/WilsonSDLCLAZSR16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/WilsonSDLCLAZSR16
Shomir Wilson, Florian Schaub, Aswarth Abhilash Dara, Frederick Liu, Sushain Cherivirala, Pedro Giovanni Leon, Mads Schaarup Andersen, Sebastian Zimmeck, Kanthashree Mysore Sathyendra, N. Cameron Russell, Thomas B. Norton, Eduard H. Hovy, Joel R. Reidenberg, Norman M. Sadeh:
The Creation and Analysis of a Website Privacy Policy Corpus. ACL (1) 2016
[c245]
- view
  authority control:
- export record
  dblp key:
  - conf/ccis/DustdarHLG16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ccis/DustdarHLG16
Schahram Dustdar, Eduard H. Hovy, Xiangyang Li, Moncef Gabbouj:
Keynote speech. CCIS 2016
[c244]
- view
  - electronic edition @ ceur-ws.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/icbo/BurnsWDH16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icbo/BurnsWDH16
Gully A. P. C. Burns, Anita de Waard, Pradeep Dasigi, Eduard H. Hovy:
Cycles of Scientific Investigation in Discourse - Machine Reading Methods for the Primary Research Contributions of a Paper. ICBO/BioCreative 2016
[c243]
- view
  - electronic edition @ aaai.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/icwsm/YangHKH16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icwsm/YangHKH16
Diyi Yang, Aaron Halfaker, Robert E. Kraut, Eduard H. Hovy:
Who Did What: Editor Role Identification in Wikipedia. ICWSM 2016: 446-455
[c242]
- view
  - electronic edition @ lrec-conf.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/lrec/YangHKH16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/YangHKH16
Diyi Yang, Aaron Halfaker, Robert E. Kraut, Eduard H. Hovy:
Edit Categories and Editor Role Identification in Wikipedia. LREC 2016
[c241]
- view
  - electronic edition @ ceur-ws.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/mediaeval/SutcliffeCHLFR16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mediaeval/SutcliffeCHLFR16
Richard F. E. Sutcliffe, Tom Collins, Eduard H. Hovy, Richard Lewis, Chris Fox, Deane L. Root:
The C@merata task at MediaEval 2016: Natural Language Queries Derived from Exam Papers, Articles and Other Sources against Classical Music Scores in MusicXML. MediaEval 2016
[c240]
- view
  authority control:
- export record
  dblp key:
  - conf/naacl/LiCHJ16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/LiCHJ16
Jiwei Li, Xinlei Chen, Eduard H. Hovy, Dan Jurafsky:
Visualizing and Understanding Neural Models in NLP. HLT-NAACL 2016: 681-691
[c239]
- view
  authority control:
- export record
  dblp key:
  - conf/naacl/MaLH16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/MaLH16
Xuezhe Ma, Zhengzhong Liu, Eduard H. Hovy:
Unsupervised Ranking Model for Entity Coreference Resolution. HLT-NAACL 2016: 1012-1018
[c238]
- view
  authority control:
- export record
  dblp key:
  - conf/naacl/YangYDHSH16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/YangYDHSH16
Zichao Yang, Diyi Yang, Chris Dyer, Xiaodong He, Alexander J. Smola, Eduard H. Hovy:
Hierarchical Attention Networks for Document Classification. HLT-NAACL 2016: 1480-1489
2015
[c237]
- view
  - electronic edition @ aaai.org (archived)
  - no references & citations available
- export record
  dblp key:
  - conf/aaai/WangHD15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/WangHD15
Haoyu Wang, Eduard H. Hovy, Mark Dredze:
The Hurricane Sandy Twitter Corpus. AAAI Workshop: WWW and Public Health Intelligence 2015
[c236]
- view
  authority control:
- export record
  dblp key:
  - conf/aclevents/FaucegliaLMH15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aclevents/FaucegliaLMH15
Nicolas R. Fauceglia, Yiu-Chang Lin, Xuezhe Ma, Eduard H. Hovy:
Word Sense Disambiguation via PropStore and OntoNotes for Event Mention Detection. EVENTS@HLP-NAACL 2015: 11-15
[c235]
- view
  authority control:
- export record
  dblp key:
  - conf/aclevents/LiuMH15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aclevents/LiuMH15
Zhengzhong Liu, Teruko Mitamura, Eduard H. Hovy:
Evaluation Algorithms for Event Nugget Detection : A Pilot Study. EVENTS@HLP-NAACL 2015: 53-57
[c234]
- view
  - electronic edition @ ceur-ws.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/clef/RodrigoPMHK15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/RodrigoPMHK15
Álvaro Rodrigo, Anselmo Peñas, Yusuke Miyao, Eduard H. Hovy, Noriko Kando:
Overview of CLEF QA Entrance Exams Task 2015. CLEF (Working Notes) 2015
[c233]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/MaH15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/MaH15
Xuezhe Ma, Eduard H. Hovy:
Efficient Inner-to-outer Greedy Algorithm for Higher-order Labeled Dependency Parsing. EMNLP 2015: 1322-1328
[c232]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/LiLJH15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/LiLJH15
Jiwei Li, Thang Luong, Dan Jurafsky, Eduard H. Hovy:
When Are Tree Structures Necessary for Deep Learning of Representations? EMNLP 2015: 2304-2314
[c231]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/YangLDH15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/YangLDH15
Diyi Yang, Alon Lavie, Chris Dyer, Eduard H. Hovy:
Humor Recognition and Humor Anchor Extraction. EMNLP 2015: 2367-2376
[c230]
- view
  - electronic edition @ ijcai.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/ijcai/SachanHX15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcai/SachanHX15
Mrinmaya Sachan, Eduard H. Hovy, Eric P. Xing:
An Active Learning Approach to Coreference Resolution. IJCAI 2015: 1312-1318
[c229]
- view
  - electronic edition @ uma.es (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/ismir/SutcliffeCFRHL15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ismir/SutcliffeCFRHL15
Richard F. E. Sutcliffe, Tim Crawford, Chris Fox, Deane L. Root, Eduard H. Hovy, Richard Lewis:
Relating Natural Language Text to Musical Passages. ISMIR 2015: 524-530
[c228]
- view
  - electronic edition @ ceur-ws.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/mediaeval/SutcliffeFRHL15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mediaeval/SutcliffeFRHL15
Richard F. E. Sutcliffe, Chris Fox, Deane L. Root, Eduard H. Hovy, Richard Lewis:
The C@merata Task at MediaEval 2015: Natural Language Queries on Classical Music Scores. MediaEval 2015
[c227]
- view
  authority control:
- export record
  dblp key:
  - conf/naacl/JauharDH15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/JauharDH15
Sujay Kumar Jauhar, Chris Dyer, Eduard H. Hovy:
Ontologically Grounded Multi-sense Representation Learning for Semantic Vector Space Models. HLT-NAACL 2015: 683-693
[c226]
- view
  authority control:
- export record
  dblp key:
  - conf/naacl/FaruquiDJDHS15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/FaruquiDJDHS15
Manaal Faruqui, Jesse Dodge, Sujay Kumar Jauhar, Chris Dyer, Eduard H. Hovy, Noah A. Smith:
Retrofitting Word Vectors to Semantic Lexicons. HLT-NAACL 2015: 1606-1615
2014
[c225]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/LuoPRH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/LuoPRH14
Xiaoqiang Luo, Sameer Pradhan, Marta Recasens, Eduard H. Hovy:
An Extension of BLANC to System Mentions. ACL (2) 2014: 24-29
[c224]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/PradhanLRHNS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/PradhanLRHNS14
Sameer Pradhan, Xiaoqiang Luo, Marta Recasens, Eduard H. Hovy, Vincent Ng, Michael Strube:
Scoring Coreference Partitions of Predicted Mentions: A Reference Implementation. ACL (2) 2014: 30-35
[c223]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/LiRH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/LiRH14
Jiwei Li, Alan Ritter, Eduard H. Hovy:
Weakly Supervised User Profile Extraction from Twitter. ACL (1) 2014: 165-174
[c222]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/SrivastavaH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/SrivastavaH14
Shashank Srivastava, Eduard H. Hovy:
Vector space semantics with frequency-driven motifs. ACL (1) 2014: 634-643
[c221]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/LiOCH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/LiOCH14
Jiwei Li, Myle Ott, Claire Cardie, Eduard H. Hovy:
Towards a General Rule for Identifying Deceptive Opinion Spam. ACL (1) 2014: 1566-1576
[c220]
- view
  authority control:
- export record
  dblp key:
  - conf/aclevents/ArakiHM14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aclevents/ArakiHM14
Jun Araki, Eduard H. Hovy, Teruko Mitamura:
Evaluation for Partial Event Coreference. EVENTS@ACL 2014: 68-76
[c219]
- view
  authority control:
- export record
  dblp key:
  - conf/cikm/LiWH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cikm/LiWH14
Jiwei Li, Xun Wang, Eduard H. Hovy:
What a Nasty Day: Exploring Mood-Weather Relationship from Twitter. CIKM 2014: 1309-1318
[c218]
- view
  - electronic edition @ ceur-ws.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/clef/PenasMRHK14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/PenasMRHK14
Anselmo Peñas, Yusuke Miyao, Álvaro Rodrigo, Eduard H. Hovy, Noriko Kando:
Overview of CLEF QA Entrance Exams Task 2014. CLEF (Working Notes) 2014: 1194-1200
[c217]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/JauharH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/JauharH14
Sujay Kumar Jauhar, Eduard H. Hovy:
Inducing Latent Semantic Relations for Structured Distributional Semantics. COLING 2014: 698-708
[c216]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/GoyalH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/GoyalH14
Kartik Goyal, Eduard H. Hovy:
Unsupervised Word Sense Induction using Distributional Statistics. COLING 2014: 1302-1310
[c215]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/DasigiH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/DasigiH14
Pradeep Dasigi, Eduard H. Hovy:
Modeling Newswire Events using Neural Networks for Anomaly Detection. COLING 2014: 1414-1422
[c214]
- view
  authority control:
- export record
  dblp key:
  - conf/dgo/KlaperH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/KlaperH14
David Klaper, Eduard H. Hovy:
A taxonomy and a knowledge portal for cybersecurity. DG.O 2014: 79-85
[c213]
- view
  authority control:
- export record
  dblp key:
  - conf/dgo/SilvaPSBH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/SilvaPSBH14
Daniel Ribeiro Silva, Andrew Philpot, Abhishek Sundararajan, Nicole Marie Bryan, Eduard H. Hovy:
Data integration from open internet sources and network detection to combat underage sex trafficking. DG.O 2014: 86-90
[c212]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/LiH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/LiH14
Jiwei Li, Eduard H. Hovy:
Sentiment Analysis on the People's Daily. EMNLP 2014: 467-476
[c211]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/LiRCH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/LiRCH14
Jiwei Li, Alan Ritter, Claire Cardie, Eduard H. Hovy:
Major Life Event Extraction from Twitter based on Congratulations/Condolences Speech Acts. EMNLP 2014: 1997-2007
[c210]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/LiH14a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/LiH14a
Jiwei Li, Eduard H. Hovy:
A Model of Coherence Based on Distributed Sentence Representation. EMNLP 2014: 2039-2048
[c209]
- view
  authority control:
- export record
  dblp key:
  - conf/emnlp/LiLH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/LiLH14
Jiwei Li, Rumeng Li, Eduard H. Hovy:
Recursive Deep Models for Discourse Parsing. EMNLP 2014: 2061-2069
[c208]
- view
  - electronic edition @ lrec-conf.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/lrec/JainBRH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/JainBRH14
Siddharth Jain, Archna Bhatia, Angelique Rein, Eduard H. Hovy:
A Corpus of Participant Roles in Contentious Discussions. LREC 2014: 1751-1756
[c207]
- view
  - electronic edition @ lrec-conf.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/lrec/LiuAHM14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/LiuAHM14
Zhengzhong Liu, Jun Araki, Eduard H. Hovy, Teruko Mitamura:
Supervised Within-Document Event Coreference using Information Propagation. LREC 2014: 4539-4544
[c206]
- view
  - electronic edition @ lrec-conf.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/lrec/ArakiLHM14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/ArakiLHM14
Jun Araki, Zhengzhong Liu, Eduard H. Hovy, Teruko Mitamura:
Detecting Subevent Structure for Event Coreference Resolution. LREC 2014: 4553-4558
[c205]
- view
  - electronic edition @ ceur-ws.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/mediaeval/SutcliffeCFRH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mediaeval/SutcliffeCFRH14
Richard F. E. Sutcliffe, Tim Crawford, Chris Fox, Deane L. Root, Eduard H. Hovy:
The C@merata Task at MediaEval 2014: Natural Language Queries on Classical Music Scores. MediaEval 2014
[c204]
- view
  - electronic edition @ ceur-ws.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/sigir/Hovy14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigir/Hovy14
Eduard H. Hovy:
Distributional Semantics for IR. SMIR@SIGIR 2014: 2-3
[c203]
- view
  authority control:
- export record
  dblp key:
  - conf/specom/Echizen-yaAUH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/specom/Echizen-yaAUH14
Hiroshi Echizen-ya, Kenji Araki, Yuzu Uchida, Eduard H. Hovy:
Automatic Post-Editing Method Using Translation Knowledge Based on Intuitive Common Parts Continuum for Statistical Machine Translation. SPECOM 2014: 129-136
[c202]
- view
  authority control:
- export record
  dblp key:
  - conf/wmt/Echizen-yaAH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wmt/Echizen-yaAH14
Hiroshi Echizen-ya, Kenji Araki, Eduard H. Hovy:
Application of Prize based on Sentence Length in Chunk-based Automatic Evaluation of Machine Translation. WMT@ACL 2014: 381-386
[c201]
- view
  authority control:
- export record
  dblp key:
  - conf/wsdm/SachanDSXH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wsdm/SachanDSXH14
Mrinmaya Sachan, Avinava Dubey, Shashank Srivastava, Eric P. Xing, Eduard H. Hovy:
Spatial compactness meets topical consistency: jointly modeling links and content for community detection. WSDM 2014: 503-512
2013
[c200]
- view
  - electronic edition @ aaai.org
  - no references & citations available
- export record
  dblp key:
  - conf/aaaiss/HovyMMU13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaaiss/HovyMMU13
Eduard H. Hovy, Vita Markman, Craig Martell, David C. Uthus:
Preface. AAAI Spring Symposium: Analyzing Microtext 2013
[c199]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/acl/GoyalJLSSH13a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/GoyalJLSSH13a
Kartik Goyal, Sujay Kumar Jauhar, Huiying Li, Mrinmaya Sachan, Shashank Srivastava, Eduard H. Hovy:
A Structured Distributional Semantic Model : Integrating Structure with Semantics. CVSM@ACL 2013: 20-29
[c198]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/acl/TratzH13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/TratzH13
Stephen Tratz, Eduard H. Hovy:
Automatic Interpretation of the English Possessive. ACL (1) 2013: 372-381
[c197]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/acl/GoyalJLSSH13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/GoyalJLSSH13
Kartik Goyal, Sujay Kumar Jauhar, Huiying Li, Mrinmaya Sachan, Shashank Srivastava, Eduard H. Hovy:
A Structured Distributional Semantic Model for Event Co-reference. ACL (2) 2013: 467-473
[c196]
- view
  authority control:
- export record
  dblp key:
  - conf/aldt/ChalupskyDHKMMORWX13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aldt/ChalupskyDHKMMORWX13
Hans Chalupsky, Robert DeMarco, Eduard H. Hovy, Paul B. Kantor, Alisa Matlin, Priyam Mitra, Birnur Ozbas, Fred S. Roberts, James Wojtowicz, Minge Xie:
Estimating Violation Risk for Fisheries Regulations. ADT 2013: 297-308
[c195]
- view
  authority control:
- export record
  dblp key:
  - conf/clef/PenasHFRSM13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/PenasHFRSM13
Anselmo Peñas, Eduard H. Hovy, Pamela Forner, Álvaro Rodrigo, Richard F. E. Sutcliffe, Roser Morante:
QA4MRE 2011-2013: Overview of Question Answering for Machine Reading Evaluation. CLEF 2013: 303-320
[c194]
- view
  - electronic edition @ ceur-ws.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/clef/PenasMHFK13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/PenasMHFK13
Anselmo Peñas, Yusuke Miyao, Eduard H. Hovy, Pamela Forner, Noriko Kando:
Overview of QA4MRE 2013 Entrance Exams Task. CLEF (Working Notes) 2013
[c193]
- view
  - electronic edition @ ceur-ws.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/clef/SutcliffePHFRFBO13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/SutcliffePHFRFBO13
Richard F. E. Sutcliffe, Anselmo Peñas, Eduard H. Hovy, Pamela Forner, Álvaro Rodrigo, Corina Forascu, Yassine Benajiba, Petya Osenova:
Overview of QA4MRE Main Task at CLEF 2013. CLEF (Working Notes) 2013
[c192]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/emnlp/SrivastavaHH13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/SrivastavaHH13
Shashank Srivastava, Dirk Hovy, Eduard H. Hovy:
A Walk-Based Semantically Enriched Tree Kernel Over Distributed Word Representations. EMNLP 2013: 1411-1416
[c191]
- view
  authority control:
- export record
  dblp key:
  - conf/icmcs/JainH13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icmcs/JainH13
Siddharth Jain, Eduard H. Hovy:
Determining leadership in contentious discussions. ICME Workshops 2013: 1-6
[c190]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/interspeech/HovyAPVLHB13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/interspeech/HovyAPVLHB13
Dirk Hovy, Gopala Krishna Anumanchipalli, Alok Parlikar, Caroline Vaughn, Adam C. Lammert, Eduard H. Hovy, Alan W. Black:
Analysis and modeling of "focus" in context. INTERSPEECH 2013: 402-406
[c189]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/HovyMVAP13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/HovyMVAP13
Eduard H. Hovy, Teruko Mitamura, Felisa Verdejo, Jun Araki, Andrew Philpot:
Events are Not Simple: Identity, Non-Identity, and Quasi-Identity. EVENTS@NAACL-HLT 2013: 21-28
[c188]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/HovyBVH13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/HovyBVH13
Dirk Hovy, Taylor Berg-Kirkpatrick, Ashish Vaswani, Eduard H. Hovy:
Learning Whom to Trust with MACE. HLT-NAACL 2013: 1120-1130
[c187]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/ranlp/Echizen-yaAH13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ranlp/Echizen-yaAH13
Hiroshi Echizen-ya, Kenji Araki, Eduard H. Hovy:
Automatic Evaluation Metric for Machine Translation that is Independent of Sentence Length. RANLP 2013: 230-236
[c186]
- view
  authority control:
- export record
  dblp key:
  - conf/www/SaqchanHH13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/www/SaqchanHH13
Mrinmaya Sachan, Dirk Hovy, Eduard H. Hovy:
Solving electrical networks to incorporate supervision in random walks. WWW (Companion Volume) 2013: 109-110
2012
[c185]
- view
- export record
  dblp key:
  - conf/clef/PenasHFRSSFBO12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/PenasHFRSSFBO12
Anselmo Peñas, Eduard H. Hovy, Pamela Forner, Álvaro Rodrigo, Richard F. E. Sutcliffe, Caroline Sporleder, Corina Forascu, Yassine Benajiba, Petya Osenova:
Overview of QA4MRE at CLEF 2012: Question Answering for Machine Reading Evaluation. CLEF (Online Working Notes/Labs/Workshop) 2012
[c184]
- view
  authority control:
- export record
  dblp key:
  - conf/dgo/WangCPLHM12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/WangCPLHM12
Hao Wang, Congxing Cai, Andrew Philpot, Mark Latonero, Eduard H. Hovy, Donald Metzler:
Data integration from open internet sources to combat sex trafficking of minors. DG.O 2012: 246-252
[c183]
- view
  - electronic edition @ lrec-conf.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/lrec/PenasHFRSFS12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/PenasHFRSFS12
Anselmo Peñas, Eduard H. Hovy, Pamela Forner, Álvaro Rodrigo, Richard F. E. Sutcliffe, Corina Forascu, Caroline Sporleder:
Evaluating Machine Reading Systems through Comprehension Tests. LREC 2012: 1143-1147
[c182]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/MetzlerCH12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/MetzlerCH12
Donald Metzler, Congxing Cai, Eduard H. Hovy:
Structured Event Retrieval over Microblog Archives. HLT-NAACL 2012: 646-655
2011
[c181]
- view
  - electronic edition @ aaai.org
  - no references & citations available
- export record
  dblp key:
  - conf/aaaiss/Mulkar-MehtaHH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaaiss/Mulkar-MehtaHH11
Rutu Mulkar-Mehta, Jerry R. Hobbs, Eduard H. Hovy:
Applications and Discovery of Granularity Structures in Natural Language Discourse. AAAI Spring Symposium: Logical Formalizations of Commonsense Reasoning 2011
[c180]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/acl/HovyVTCH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/HovyVTCH11
Dirk Hovy, Ashish Vaswani, Stephen Tratz, David Chiang, Eduard H. Hovy:
Models and Training for Unsupervised Preposition Sense Disambiguation. ACL (2) 2011: 323-328
[c179]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/acl/MetzlerHZ11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/MetzlerHZ11
Donald Metzler, Eduard H. Hovy, Chunliang Zhang:
An Empirical Evaluation of Data-Driven Paraphrase Generation Techniques. ACL (2) 2011: 546-551
[c178]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/acl/HovyZHP11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/HovyZHP11
Dirk Hovy, Chunliang Zhang, Eduard H. Hovy, Anselmo Peñas:
Unsupervised Discovery of Domain-Specific Knowledge from Text. ACL 2011: 1466-1475
[c177]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/acl/KozarevaH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/KozarevaH11
Zornitsa Kozareva, Eduard H. Hovy:
Insights from Network Structure for Text Mining. ACL 2011: 1616-1625
[c176]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/bionlp/PokkunuriRRHB11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bionlp/PokkunuriRRHB11
Sandeep Pokkunuri, Cartic Ramakrishnan, Ellen Riloff, Eduard H. Hovy, Gully Burns:
The Role of Information Extraction in the Design of a Document Triage Application for Biocuration. BioNLP@ACL 2011: 46-55
[c175]
- view
- export record
  dblp key:
  - conf/clef/PenasHFRSFS11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/PenasHFRSFS11
Anselmo Peñas, Eduard H. Hovy, Pamela Forner, Álvaro Rodrigo, Richard F. E. Sutcliffe, Corina Forascu, Caroline Sporleder:
Overview of QA4MRE at CLEF 2011: Question Answering for Machine Reading Evaluation. CLEF (Notebook Papers/Labs/Workshop) 2011
[c174]
- view
  authority control:
- export record
  dblp key:
  - conf/comgeo/CaiH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/comgeo/CaiH11
Congxing Cai, Eduard H. Hovy:
Summarizing textual information about locations. COM.Geo 2011: 8:1-8:9
[c173]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/emnlp/GouwsHM11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/GouwsHM11
Stephan Gouws, Eduard H. Hovy, Donald Metzler:
Unsupervised Mining of Lexical Variants from Noisy Text. ULNLP@EMNLP 2011: 82-90
[c172]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/emnlp/TratzH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/TratzH11
Stephen Tratz, Eduard H. Hovy:
A Fast, Accurate, Non-Projective, Semantically-Enriched Parser. EMNLP 2011: 1257-1268
[c171]
- view
  - electronic edition @ aaai.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/flairs/Mulkar-MehtaWHH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/flairs/Mulkar-MehtaWHH11
Rutu Mulkar-Mehta, Christopher A. Welty, Jerry R. Hobbs, Eduard H. Hovy:
Using Part-Of Relations for Discovering Causality. FLAIRS 2011
[c170]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/iwcs/Hovy11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iwcs/Hovy11
Eduard H. Hovy:
A New Semantics: Merging Propositional and Distributional Information. IWCS 2011
[c169]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/iwcs/Mulkar-MehtaHH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iwcs/Mulkar-MehtaHH11
Rutu Mulkar-Mehta, Jerry R. Hobbs, Eduard H. Hovy:
Granularity in Natural Language Discourse. IWCS 2011
[c168]
- view
  authority control:
- export record
  dblp key:
  - conf/kcap/Mulkar-MehtaGHH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kcap/Mulkar-MehtaGHH11
Rutu Mulkar-Mehta, Andrew S. Gordon, Jerry R. Hobbs, Eduard H. Hovy:
Causal markers across domains and genres of discourse. K-CAP 2011: 183-184
[c167]
- view
  - electronic edition @ isca-speech.org (archived)
  - no references & citations available
- export record
  dblp key:
  - conf/mlslp/Hovy11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mlslp/Hovy11
Eduard H. Hovy:
On the role of machine learning in NLP. MLSLP 2011
[c166]
- view
  authority control:
- export record
  dblp key:
  - conf/semco/KozarevaH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/semco/KozarevaH11
Zornitsa Kozareva, Eduard H. Hovy:
Learning Temporal Information for States and Events. ICSC 2011: 424-429
2010
[c165]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/acl/Hovy10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/Hovy10
Eduard H. Hovy:
Negation and modality in distributional semantics. NeSp-NLP@ACL 2010: 50
[c164]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/acl/TratzH10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/TratzH10
Stephen Tratz, Eduard H. Hovy:
A Taxonomy, Dataset, and Classifier for Automatic Noun Compound Interpretation. ACL 2010: 678-687
[c163]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/acl/RecasensH10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/RecasensH10
Marta Recasens, Eduard H. Hovy:
Coreference Resolution across Corpora: Languages, Coding Schemes, and Preprocessing Information. ACL 2010: 1423-1432
[c162]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/acl/KozarevaH10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/KozarevaH10
Zornitsa Kozareva, Eduard H. Hovy:
Learning Arguments and Supertypes of Semantic Relations Using Recursive Patterns. ACL 2010: 1482-1491
[c161]
- view
- export record
  dblp key:
  - conf/clef/RodrigoPHP10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/RodrigoPHP10
Álvaro Rodrigo, Anselmo Peñas, Eduard H. Hovy, Emanuele Pianta:
Question Answering for Machine Reading Evaluation. CLEF (Notebook Papers/LABs/Workshops) 2010
[c160]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/HovyTH10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/HovyTH10
Dirk Hovy, Stephen Tratz, Eduard H. Hovy:
What's in a Preposition? Dimensions of Sense Disambiguation for an Interesting Word Class. COLING (Posters) 2010: 454-462
[c159]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/PenasH10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/PenasH10
Anselmo Peñas, Eduard H. Hovy:
Filling Knowledge Gaps in Text for Machine Reading. COLING (Posters) 2010: 979-987
[c158]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/emnlp/KozarevaH10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/KozarevaH10
Zornitsa Kozareva, Eduard H. Hovy:
A Semi-Supervised Method to Learn and Construct Taxonomies Using the Web. EMNLP 2010: 1110-1118
[c157]
- view
  - electronic edition @ lrec-conf.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/lrec/RecasensHM10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/RecasensHM10
Marta Recasens, Eduard H. Hovy, Maria Antònia Martí:
A Typology of Near-Identity Relations for Coreference (NIDENT). LREC 2010
[c156]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/CaiH10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/CaiH10
Congxing Cai, Eduard H. Hovy:
Summarizing Textual Information about Locations In a Geo-Spatial Information Display System. NAACL (Demos) 2010: 5-8
[c155]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/KozarevaH10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/KozarevaH10
Zornitsa Kozareva, Eduard H. Hovy:
Not All Seeds Are Equal: Measuring the Quality of Text Mining Seeds. HLT-NAACL 2010: 618-626
[c154]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/semeval/TratzH10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/semeval/TratzH10
Stephen Tratz, Eduard H. Hovy:
ISI: Automatic Classification of Relations Between Nominals Using a Maximum Entropy Classifier. SemEval@ACL 2010: 222-225
2009
[c153]
- view
  - electronic edition @ aaai.org
  - no references & citations available
- export record
  dblp key:
  - conf/aaaifs/MarcoWH09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaaifs/MarcoWH09
Chrysanne Di Marco, David Wiljer, Eduard H. Hovy:
Self-Managed Access to Personalized Healthcare through Automated Generation of Tailored Health Educational Materials from Electronic Health Records. AAAI Fall Symposium: Virtual Healthcare Interaction 2009
[c152]
- view
  - electronic edition @ aaai.org
  - no references & citations available
- export record
  dblp key:
  - conf/aaaiss/KozarevaHR09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaaiss/KozarevaHR09
Zornitsa Kozareva, Eduard H. Hovy, Ellen Riloff:
Learning and Evaluating the Content and Structure of a Term Taxonomy. AAAI Spring Symposium: Learning by Reading and Learning to Read 2009: 50-57
[c151]
- view
  authority control:
- export record
  dblp key:
  - conf/daarc/RecasensH09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/daarc/RecasensH09
Marta Recasens, Eduard H. Hovy:
A Deeper Look into Features for Coreference Resolution. DAARC 2009: 29-42
[c150]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/emnlp/HovyKR09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/HovyKR09
Eduard H. Hovy, Zornitsa Kozareva, Ellen Riloff:
Toward Completeness in Concept Extraction and Classification. EMNLP 2009: 948-957
[c149]
- view
  authority control:
- export record
  dblp key:
  - conf/kcap/BhagatHP09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kcap/BhagatHP09
Rahul Bhagat, Eduard H. Hovy, Siddharth Patwardhan:
Acquiring paraphrases from text corpora. K-CAP 2009: 161-168
[c148]
- view
  authority control:
- export record
  dblp key:
  - conf/nldb/Hovy09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/nldb/Hovy09
Eduard H. Hovy:
Turning the Web into a Database: Extracting Data and Structure. NLDB 2009: 1-7
2008
[c147]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/acl/KozarevaRH08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/KozarevaRH08
Zornitsa Kozareva, Ellen Riloff, Eduard H. Hovy:
Semantic Class Learning from the Web with Hyponym Pattern Linkage Graphs. ACL 2008: 1048-1056
[c146]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/bionlp/FengBH08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/bionlp/FengBH08
Donghui Feng, Gully Burns, Eduard H. Hovy:
Adaptive Information Extraction for Complex Biomedical Tasks. BioNLP 2008: 120-121
[c145]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/YuWH08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/YuWH08
Liang-Chih Yu, Chung-Hsien Wu, Eduard H. Hovy:
OntoNotes: Corpus Cleanup of Mistaken Agreement Using Word Sense Disambiguation. COLING 2008: 1057-1064
[c144]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/ZhuWH08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/ZhuWH08
Jingbo Zhu, Huizhen Wang, Eduard H. Hovy:
Multi-Criteria-Based Strategy to Stop Active Learning for Data Annotation. COLING 2008: 1129-1136
[c143]
- view
  authority control:
- export record
  dblp key:
  - conf/hicss/ShulmanKHH08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/hicss/ShulmanKHH08
Stuart W. Shulman, Namhee Kwon, Eduard H. Hovy, Emily Huisman:
Tools for Rules: Technology Transfer and Electronic Rulemaking. HICSS 2008: 200
[c142]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/ijcnlp/ZhuWH08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcnlp/ZhuWH08
Jingbo Zhu, Huizhen Wang, Eduard H. Hovy:
Learning a Stopping Criterion for Active Learning for Word Sense Disambiguation and Text Classification. IJCNLP 2008: 366-372
[c141]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/ijcnlp/FengBZH08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcnlp/FengBZH08
Donghui Feng, Gully Burns, Jingbo Zhu, Eduard H. Hovy:
Towards Automated Semantic Analysis on Biomedical Research Articles. IJCNLP 2008: 871-876
[c140]
- view
  - electronic edition @ lrec-conf.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/lrec/HartholtRTHR08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/HartholtRTHR08
Arno Hartholt, Thomas A. Russ, David R. Traum, Eduard H. Hovy, Susan Robinson:
A Common Ground for Virtual Humans: Using an Ontology in a Natural Language Oriented Virtual Human Architecture. LREC 2008
[c139]
- view
  authority control:
- export record
  dblp key:
  - conf/sofsem/ShinHM08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sofsem/ShinHM08
Hyun Woong Shin, Eduard H. Hovy, Dennis McLeod:
The Dynamic Web Presentations with a Generality Model on the News Domain. SOFSEM 2008: 755-765
2007
[c138]
- view
  authority control:
- export record
  dblp key:
  - conf/IEEEscc/BurnsFIH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/IEEEscc/BurnsFIH07
Gully Burns, Donghui Feng, Tommy Ingulfsen, Eduard H. Hovy:
Infrastructure for Annotation-Driven Information Extraction from the Primary Scientific Literature: Principles and Practice. IEEE SCW 2007: 122-129
[c137]
- view
  - electronic edition @ aaai.org (archived)
  - no references & citations available
- export record
  dblp key:
  - conf/aaai/BarkerACFFGHHIKMPPTY07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/BarkerACFFGHHIKMPPTY07
Ken Barker, Bhalchandra Agashe, Shaw Yi Chaw, James Fan, Noah S. Friedland, Michael Robert Glass, Jerry R. Hobbs, Eduard H. Hovy, David J. Israel, Doo Soon Kim, Rutu Mulkar-Mehta, Sourabh Patwardhan, Bruce W. Porter, Dan Tecuci, Peter Z. Yeh:
Learning by Reading: A Prototype System, Performance Baseline and Lessons Learned. AAAI 2007: 280-286
[c136]
- view
  - electronic edition @ aaai.org
  - no references & citations available
- export record
  dblp key:
  - conf/aaaiss/MulkarHH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaaiss/MulkarHH07
Rutu Mulkar, Jerry R. Hobbs, Eduard H. Hovy:
Learning from Reading Syntactically Complex Biology Texts. AAAI Spring Symposium: Logical Formalizations of Commonsense Reasoning 2007: 132-137
[c135]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/acl/YuWLHL07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/YuWLHL07
Liang-Chih Yu, Chung-Hsien Wu, Chin-Yew Lin, Eduard H. Hovy, Chia-Ling Lin:
Topic Analysis for Psychiatric Document Retrieval. ACL 2007
[c134]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/KwonZHS07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/KwonZHS07
Namhee Kwon, Liang Zhou, Eduard H. Hovy, Stuart W. Shulman:
Identifying and classifying subjective claims. DG.O 2007: 76-81
[c133]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/PantelPH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/PantelPH07
Patrick Pantel, Andrew Philpot, Eduard H. Hovy:
Data integration in the wild: from instances to concept catalogs. DG.O 2007: 264-265
[c132]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/Hovy07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/Hovy07
Eduard H. Hovy:
Government perspective: panel: international developments in digital government. DG.O 2007: 336
[c131]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/Hovy07a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/Hovy07a
Eduard H. Hovy:
Research perspective: panel: international developments in digital government. DG.O 2007: 337-338
[c130]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/emnlp/BhagatPH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/BhagatPH07
Rahul Bhagat, Patrick Pantel, Eduard H. Hovy:
LEDIR: An Unsupervised Algorithm for Learning Directionality of Inference Rules. EMNLP-CoNLL 2007: 161-170
[c129]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/emnlp/ZhuH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/ZhuH07
Jingbo Zhu, Eduard H. Hovy:
Active Learning for Word Sense Disambiguation with Methods for Addressing the Class Imbalance Problem. EMNLP-CoNLL 2007: 783-790
[c128]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/emnlp/FengBH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/FengBH07
Donghui Feng, Gully Burns, Eduard H. Hovy:
Extracting Data Records from Unstructured Biomedical Full Text. EMNLP-CoNLL 2007: 837-846
[c127]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/emnlp/KimH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/KimH07
Soo-Min Kim, Eduard H. Hovy:
Crystal: Analyzing Predictive Opinions on the Web. EMNLP-CoNLL 2007: 1056-1064
[c126]
- view
  - electronic edition @ ijcai.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/ijcai/BhagatH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcai/BhagatH07
Rahul Bhagat, Eduard H. Hovy:
Phonetic Models for Generating Spelling Variants. IJCAI 2007: 1570-1575
[c125]
- view
  authority control:
- export record
  dblp key:
  - conf/kcap/KwonH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kcap/KwonH07
Namhee Kwon, Eduard H. Hovy:
Information acquisition using multiple classifications. K-CAP 2007: 111-118
[c124]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/ZhouKH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/ZhouKH07
Liang Zhou, Namhee Kwon, Eduard H. Hovy:
A Semi-Automatic Evaluation Scheme: Automated Nuggetization for Manual Annotation. HLT-NAACL (Short Papers) 2007: 217-220
[c123]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/PantelBCCH07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/PantelBCCH07
Patrick Pantel, Rahul Bhagat, Bonaventura Coppola, Timothy Chklovski, Eduard H. Hovy:
ISP: Learning Inferential Selectional Preferences. HLT-NAACL 2007: 564-571
[c122]
- view
  authority control:
- export record
  dblp key:
  - conf/semco/PradhanHMPRW07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/semco/PradhanHMPRW07
Sameer S. Pradhan, Eduard H. Hovy, Mitchell P. Marcus, Martha Palmer, Lance A. Ramshaw, Ralph M. Weischedel:
OntoNotes: A Unified Relational Semantic Representation. ICSC 2007: 517-526
2006
[c121]
- view
  - electronic edition @ aaai.org (archived)
  - no references & citations available
- export record
  dblp key:
  - conf/aaai/FengRH06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/FengRH06
Donghui Feng, Deepak Ravichandran, Eduard H. Hovy:
Mining and Re-ranking for Answering Biographical Queries on the Web. AAAI 2006: 1283-1288
[c120]
- view
  - electronic edition @ aaai.org (archived)
  - no references & citations available
- export record
  dblp key:
  - conf/aaai/FengKSH06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/FengKSH06
Donghui Feng, Jihie Kim, Erin Shaw, Eduard H. Hovy:
Towards Modeling Threaded Discussions using Induced Ontology Knowledge. AAAI 2006: 1289-1294
[c119]
- view
  - electronic edition @ aaai.org
  - no references & citations available
- export record
  dblp key:
  - conf/aaaiss/MarcoCBCCHLM06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaaiss/MarcoCBCCHLM06
Chrysanne Di Marco, Donald D. Cowan, Peter Bray, H. Dominic Covvey, Vic Di Ciccio, Eduard H. Hovy, Joan Lipa, Douglas W. Mulholland:
A Physician's Authoring Tool for Generation of Personalized Health Education in Reconstructive Surgery. AAAI Spring Symposium: Argumentation for Consumers of Healthcare 2006: 39-46
[c118]
- view
  - electronic edition @ aaai.org
  - no references & citations available
- export record
  dblp key:
  - conf/aaaiss/ZhouH06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaaiss/ZhouH06
Liang Zhou, Eduard H. Hovy:
On the Summarization of Dynamically Introduced Information: Online Discussions and Blogs. AAAI Spring Symposium: Computational Approaches to Analyzing Weblogs 2006: 237-
[c117]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/acl/KimH06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/KimH06
Soo-Min Kim, Eduard H. Hovy:
Automatic Identification of Pro and Con Reasons in Online Reviews. ACL 2006
[c116]
- view
  - electronic edition @ amia.org (archived)
  - no references & citations available
- export record
  dblp key:
  - conf/amia/MarcoBCCCHLY06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/amia/MarcoBCCCHLY06
Chrysanne Di Marco, Peter Bray, H. Dominic Covvey, Donald D. Cowan, Vic Di Ciccio, Eduard H. Hovy, Joan Lipa, C. Yang:
Authoring and Generation of Individualized Patient Education Materials. AMIA 2006
[c115]
- view
  authority control:
- export record
  dblp key:
  - conf/cicling/KwonH06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cicling/KwonH06
Namhee Kwon, Eduard H. Hovy:
Integrating Semantic Frames from Multiple Sources. CICLing 2006: 1-12
[c114]
- view
  authority control:
- export record
  dblp key:
  - conf/dgo/KwonSH06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/KwonSH06
Namhee Kwon, Stuart W. Shulman, Eduard H. Hovy:
Multidimensional text analysis for eRulemaking. DG.O 2006: 157-166
[c113]
- view
  authority control:
- export record
  dblp key:
  - conf/dgo/ShulmanHCZ06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/ShulmanHCZ06
Stuart W. Shulman, Eduard H. Hovy, Jamie Callan, Stephen Zavestoski:
Progress in language processing technology for electronic rulemaking. DG.O 2006: 249-250
[c112]
- view
  authority control:
- export record
  dblp key:
  - conf/dgo/CushingWBDBFSSFHHJLSBGS06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/CushingWBDBFSSFHHJLSBGS06
Judith Bayard Cushing, Tyrone Wilson, Alan Borning, Lois M. L. Delcambre, Geoffrey C. Bowker, Mike Frame, John L. Schnase, William Sonntag, János Fülöp, Carol A. Hert, Eduard H. Hovy, Julia Jones, Eric Landis, Charles M. Schweik, Lawrence Brandt, Valerie Gregg, Sylvia Spengler:
Eco-informatics and natural resource management. DG.O 2006: 381-382
[c111]
- view
  authority control:
- export record
  dblp key:
  - conf/dgo/HovyPP06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/HovyPP06
Eduard H. Hovy, Andrew Philpot, Patrick Pantel:
Entity consolidation and alignment in semi-structured data sources. DG.O 2006: 400-401
[c110]
- view
  authority control:
- export record
  dblp key:
  - conf/dgo/PantelPH06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/PantelPH06
Patrick Pantel, Andrew Philpot, Eduard H. Hovy:
Matching and integration across heterogeneous data sources. DG.O 2006: 438-439
[c109]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/emnlp/ZhouLH06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/ZhouLH06
Liang Zhou, Chin-Yew Lin, Eduard H. Hovy:
Re-evaluating Machine Translation Results with Paraphrase Support. EMNLP 2006: 77-84
[c108]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - conf/esws/Hovy06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/esws/Hovy06
Eduard H. Hovy:
Toward Large-Scale Shallow Semantics for Higher-Quality NLP. ESWC 2006: 2
[c107]
- view
  authority control:
- export record
  dblp key:
  - conf/icde/ShinHMP06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/icde/ShinHMP06
Hyun Woong Shin, Eduard H. Hovy, Dennis McLeod, Larry Pryor:
Measuring Generality of Documents. ICDE Workshops 2006: 62
[c106]
- view
  authority control:
- export record
  dblp key:
  - conf/iui/FleischmanH06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iui/FleischmanH06
Michael Fleischman, Eduard H. Hovy:
Taking advantage of the situation: non-linguistic context for natural language interfaces to interactive virtual environments. IUI 2006: 47-54
[c105]
- view
  authority control:
- export record
  dblp key:
  - conf/iui/FengSKH06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iui/FengSKH06
Donghui Feng, Erin Shaw, Jihie Kim, Eduard H. Hovy:
An intelligent discussion-bot for answering student queries in threaded discussions. IUI 2006: 171-177
[c104]
- view
  - electronic edition @ lrec-conf.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/lrec/RambowDFGHHHLMM06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/RambowDFGHHHLMM06
Owen Rambow, Bonnie J. Dorr, David Farwell, Rebecca Green, Nizar Habash, Stephen Helmreich, Eduard H. Hovy, Lori S. Levin, Keith J. Miller, Teruko Mitamura, Florence Reeder, Advaith Siddharthan:
Parallel Syntactic Annotation of Multiple Languages. LREC 2006: 559-564
[c103]
- view
  - electronic edition @ lrec-conf.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/lrec/ZhouLH06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/ZhouLH06
Liang Zhou, Chin-Yew Lin, Eduard H. Hovy:
Summarizing Answers for Complicated Questions. LREC 2006: 737-740
[c102]
- view
  - electronic edition @ lrec-conf.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/lrec/HovyLZF06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/HovyLZF06
Eduard H. Hovy, Chin-Yew Lin, Liang Zhou, Junichi Fukumoto:
Automated Summarization Evaluation with Basic Elements. LREC 2006: 899-902
[c101]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/FengSKH06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/FengSKH06
Donghui Feng, Erin Shaw, Jihie Kim, Eduard H. Hovy:
Learning to Detect Conversation Focus of Threaded Discussions. HLT-NAACL 2006
[c100]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/HovyMPRW06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/HovyMPRW06
Eduard H. Hovy, Mitchell P. Marcus, Martha Palmer, Lance A. Ramshaw, Ralph M. Weischedel:
OntoNotes: The 90% Solution. HLT-NAACL 2006
[c99]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/KimH06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/KimH06
Soo-Min Kim, Eduard H. Hovy:
Identifying and Analyzing Judgment Opinions. HLT-NAACL 2006
[c98]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/ZhouLMH06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/ZhouLMH06
Liang Zhou, Chin-Yew Lin, Dragos Stefan Munteanu, Eduard H. Hovy:
ParaEval: Using Paraphrases to Evaluate Summaries Automatically. HLT-NAACL 2006
[c97]
- view
  authority control:
- export record
  dblp key:
  - conf/tsd/Hovy06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tsd/Hovy06
Eduard H. Hovy:
Learning by Reading: An Experiment in Text Analysis. TSD 2006: 3-12
2005
[c96]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/ZhouH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/ZhouH05
Liang Zhou, Eduard H. Hovy:
Digesting Virtual "Geek" Culture: The Summarization of Technical Internet Relay Chats. ACL 2005: 298-305
[c95]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/RavichandranPH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/RavichandranPH05
Deepak Ravichandran, Patrick Pantel, Eduard H. Hovy:
Randomized Algorithms and NLP: Using Locality Sensitive Hash Functions for High Speed Noun Clustering. ACL 2005: 622-629
[c94]
- no documents available
  - no references & citations available
- export record
  dblp key:
  - conf/clin/Hovy05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clin/Hovy05
Eduard H. Hovy:
Toward Large-Scale Shallow Semantics for Higher-Quality NLP. CLIN 2005
[c93]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/ShulmanHCZ05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/ShulmanHCZ05
Stuart W. Shulman, Eduard H. Hovy, Jamie Callan, Stephen Zavestoski:
Language processing technologies for electronic rulemaking: a project highlight. DG.O 2005: 87-88
[c92]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/PantelPH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/PantelPH05
Patrick Pantel, Andrew Philpot, Eduard H. Hovy:
Aligning database columns using mutual information. DG.O 2005: 205-210
[c91]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/CushingWBDBFSSFHHJLSBGS05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/CushingWBDBFSSFHHJLSBGS05
Judith Bayard Cushing, Tyrone Wilson, Alan Borning, Lois M. L. Delcambre, Geoffrey C. Bowker, Mike Frame, John L. Schnase, William Sonntag, János Fülöp, Carol A. Hert, Eduard H. Hovy, Julia Jones, Eric Landis, Charles M. Schweik, Lawrence Brandt, Valerie Gregg, Sylvia Spengler:
Eco-informatics and natural resource management. DG.O 2005: 211-212
[c90]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/PhilpotPH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/PhilpotPH05
Andrew Philpot, Patrick Pantel, Eduard H. Hovy:
Significance information for translation: air quality data integration. DG.O 2005: 233-234
[c89]
- view
  authority control:
- export record
  dblp key:
  - conf/iccs/Hovy05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iccs/Hovy05
Eduard H. Hovy:
Methodologies for the Reliable Construction of Ontological Knowledge. ICCS 2005: 91-106
[c88]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/ijcnlp/KimH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcnlp/KimH05
Soo-Min Kim, Eduard H. Hovy:
Automatic Detection of Opinion Bearing Words and Sentences. IJCNLP (companion) 2005
[c87]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/ijcnlp/PhilpotHP05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcnlp/PhilpotHP05
Andrew Philpot, Eduard H. Hovy, Patrick Pantel:
The Omega Ontology. OntoLex@IJCNLP 2005
[c86]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/iwpt/BhagatLH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iwpt/BhagatLH05
Rahul Bhagat, Anton Leuski, Eduard H. Hovy:
Statistical Shallow Semantic Parsing despite Little Training Data. IWPT 2005: 186-187
[c85]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/ZhouSLH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/ZhouSLH05
Liang Zhou, Erin Shaw, Chin-Yew Lin, Eduard H. Hovy:
Classummary: Introducing Discussion Summarization to Online Classrooms. HLT/EMNLP 2005: 4-5
[c84]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/FengH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/FengH05
Donghui Feng, Eduard H. Hovy:
Handling Biographical Questions with Implicature. HLT/EMNLP 2005: 596-603
[c83]
- no documents available
  - no references & citations available
- export record
  dblp key:
  - conf/nlucs/FengH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/nlucs/FengH05
Donghui Feng, Eduard H. Hovy:
MRE: A Study on Evolutionary Language Understanding. NLUCS 2005: 45-54
[c82]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/sigdial/TraumSGMKHNFMBR05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sigdial/TraumSGMKHNFMBR05
David R. Traum, William R. Swartout, Jonathan Gratch, Stacy Marsella, Patrick G. Kenny, Eduard H. Hovy, Shri Narayanan, Ed Fast, Bilyana Martinovski, Rahul Baghat, Susan Robinson, Andrew Marshall, Dagen Wang, Sudeep Gandhe, Anton Leuski:
Dealing with Doctors: A Virtual Human for Non-team Interaction. SIGDIAL Workshop 2005: 232-236
[c81]
- no documents available
  - no references & citations available
- export record
  dblp key:
  - conf/ssdbm/PantelPH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ssdbm/PantelPH05
Patrick Pantel, Andrew Philpot, Eduard H. Hovy:
An Information Theoretic Model for Database Alignment. SSDBM 2005: 14-23
2004
[c80]
- view
  - electronic edition @ aaai.org
  - no references & citations available
- export record
  dblp key:
  - conf/aaaifs/SwartoutGHHMRT04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaaifs/SwartoutGHHMRT04
William R. Swartout, Jonathan Gratch, Randall W. Hill Jr., Eduard H. Hovy, Stacy Marsella, Jeff Rickel, David R. Traum:
Towards Virtual Humans. AAAI Technical Report (1) 2004: 70-77
[c79]
- view
  authority control:
- export record
  dblp key:
  - conf/amta/ReederDFHHHLMMRS04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/amta/ReederDFHHHLMMRS04
Florence Reeder, Bonnie J. Dorr, David Farwell, Nizar Habash, Stephen Helmreich, Eduard H. Hovy, Lori S. Levin, Teruko Mitamura, Keith J. Miller, Owen Rambow, Advaith Siddharthan:
Interlingual Annotation for MT Development. AMTA 2004: 236-245
[c78]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/KimH04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/KimH04
Soo-Min Kim, Eduard H. Hovy:
Determining the Sentiment of Opinions. COLING 2004
[c77]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/KwonFH04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/KwonFH04
Namhee Kwon, Michael Fleischman, Eduard H. Hovy:
FrameNet-based Semantic Parsing using Maximum Entropy Models. COLING 2004
[c76]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/PantelRH04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/PantelRH04
Patrick Pantel, Deepak Ravichandran, Eduard H. Hovy:
Towards Terascale Semantic Acquisition. COLING 2004
[c75]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/HovyF04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/HovyF04
Eduard H. Hovy, Stefan Falke:
Automating the Integration of Heterogeneous Databases. DG.O 2004
[c74]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/HovyPD04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/HovyPD04
Eduard H. Hovy, Andrew Philpot, Lei Ding:
DGRC AskCal: A Multilingual Question Answering Agent for Heterogeneous Energy Databases. DG.O 2004
[c73]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/HovyPD04a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/HovyPD04a
Eduard H. Hovy, Andrew Philpot, Lei Ding:
Multilingual DGRC AskCal: Querying Energy Time Series in English, Spanish, and Mandarin Chinese. DG.O 2004
[c72]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/PhilpotHF04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/PhilpotHF04
Andrew Philpot, Eduard H. Hovy, Stefan Falke:
EPA-AIR SIfT: Air Quality Data Integration from Heterogeneous Sources. DG.O 2004
[c71]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/ShulmanHZC04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/ShulmanHZC04
Stuart W. Shulman, Eduard H. Hovy, Stephen Zavestoski, Jamie Callan:
SGER Collaborative: A Testbed for eRulemaking Data. DG.O 2004
[c70]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/emnlp/ZhouTH04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/ZhouTH04
Liang Zhou, Miruna Ticrea, Eduard H. Hovy:
Multi-Document Biography Summarization. EMNLP 2004: 434-441
[c69]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/HelmreichFDHLMR04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/HelmreichFDHLMR04
Stephen Helmreich, David Farwell, Bonnie J. Dorr, Nizar Habash, Lori S. Levin, Teruko Mitamura, Florence Reeder, Keith J. Miller, Eduard H. Hovy, Owen Rambow, Advaith Siddharthan:
Interlingual Annotation of Multilingual Text Corpora. FCP@NAACL-HLT 2004
[c68]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/semeval/KwonFH04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/semeval/KwonFH04
Namhee Kwon, Michael Fleischman, Eduard H. Hovy:
Senseval automatic labeling of semantic roles using Maximum Entropy models. SENSEVAL@ACL 2004
[c67]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/trec/KimRH04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/KimRH04
Soo-Min Kim, Deepak Ravichandran, Eduard H. Hovy:
ISI Novelty Track System for TREC 2004. TREC 2004
2003
[c66]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/FleischmanHE03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/FleischmanHE03
Michael Fleischman, Eduard H. Hovy, Abdessamad Echihabi:
Offline Strategies for Online Question Answering: Answering Questions Before They Are Asked. ACL 2003: 1-7
[c65]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/LeuskiLH03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/LeuskiLH03
Anton Leuski, Chin-Yew Lin, Eduard H. Hovy:
iNeATS: Interactive Multi-Document Summarization. ACL (Companion) 2003: 125-128
[c64]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/HovyPKGD03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/HovyPKGD03
Eduard H. Hovy, Andrew Philpot, Judith Klavans, Ulrich Germann, Peter T. Davis:
Extending Metadata Definitions by Automatically Extracting and Organizing Glossary Definitions. DG.O 2003
[c63]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/emnlp/FleischmanKH03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/FleischmanKH03
Michael Fleischman, Namhee Kwon, Eduard H. Hovy:
Maximum Entropy Models for FrameNet Classification. EMNLP 2003
[c62]
- view
  authority control:
- export record
  dblp key:
  - conf/iui/FleischmanH03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iui/FleischmanH03
Michael Fleischman, Eduard H. Hovy:
Recommendations without user preferences: a natural language processing approach. IUI 2003: 242-244
[c61]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/mtsummit/DienHH03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mtsummit/DienHH03
Dinh Dien, Kiem Hoang, Eduard H. Hovy:
BTL: a hybrid model for English-Vietnamese machine translation. MTSummit 2003
[c60]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/mtsummit/KingPH03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mtsummit/KingPH03
Margaret King, Andrei Popescu-Belis, Eduard H. Hovy:
FEMTI: creating and using a framework for MT evaluation. MTSummit 2003
[c59]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/FleischmanH03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/FleischmanH03
Michael Fleischman, Eduard H. Hovy:
A Maximum Entropy Approach to FrameNet Tagging. HLT-NAACL 2003
[c58]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/LinH03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/LinH03
Chin-Yew Lin, Eduard H. Hovy:
Automatic Evaluation of Summaries Using N-gram Co-occurrence Statistics. HLT-NAACL 2003
[c57]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/ZhouH03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/ZhouH03
Liang Zhou, Eduard H. Hovy:
A Web-Trained Extraction Summarization System. HLT-NAACL 2003
[c56]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/trec/EchihabiHHMMR03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/EchihabiHHMMR03
Abdessamad Echihabi, Ulf Hermjakob, Eduard H. Hovy, Daniel Marcu, Eric Melz, Deepak Ravichandran:
Multiple-Engine Question Answering in TextMap. TREC 2003: 772-781
2002
[c55]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/RavichandranH02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/RavichandranH02
Deepak Ravichandran, Eduard H. Hovy:
Learning surface text patterns for a Question Answering System. ACL 2002: 41-47
[c54]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/LinH02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/LinH02
Chin-Yew Lin, Eduard H. Hovy:
From Single to Multi-document Summarization. ACL 2002: 457-464
[c53]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/FleischmanH02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/FleischmanH02
Michael Fleischman, Eduard H. Hovy:
Fine Grained Classification of Named Entities. COLING 2002
[c52]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/HovyHLR02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/HovyHLR02
Eduard H. Hovy, Ulf Hermjakob, Chin-Yew Lin, Deepak Ravichandran:
Using Knowledge to Facilitate Factoid Answer Pinpointing. COLING 2002
[c51]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/AmbiteABDHKPPRSSTZ02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/AmbiteABDHKPPRSSTZ02
José Luis Ambite, Yigal Arens, Walter Bourne, Peter T. Davis, Eduard H. Hovy, Judith L. Klavans, Andrew Philpot, Samuel D. Popper, Kenneth A. Ross, Ju-Ling Shih, Peter Sommer, Surabhan Temiyabutr, Laura Zadoff:
A Portal for Access to Complex Distributed Information about Energy. DG.O 2002
[c50]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/PhilpotAH02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/PhilpotAH02
Andrew Philpot, José Luis Ambite, Eduard H. Hovy:
DGRC AskCal: Natural Language Question Answering for Energy Time Series. DG.O 2002
[c49]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/inlg/FleischmanH02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/inlg/FleischmanH02
Michael Fleischman, Eduard H. Hovy:
Towards Emotional Variation in Speech-Based Natural Language Processing. INLG 2002: 57-64
[c48]
- view
  - electronic edition @ lrec-conf.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/lrec/HovyKP02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/HovyKP02
Eduard H. Hovy, Margaret King, Andrei Popescu-Belis:
Computer-Aided Specification of Quality Models for Machine Translation Evaluation. LREC 2002
[c47]
- view
  authority control:
- export record
  dblp key:
  - conf/pricai/Hovy02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pricai/Hovy02
Eduard H. Hovy:
Learning, Collecting, and Using Ontological Knowledge for NLP. PRICAI 2002: 6
2001
[c46]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/HovyGHLR01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/HovyGHLR01
Eduard H. Hovy, Laurie Gerber, Ulf Hermjakob, Chin-Yew Lin, Deepak Ravichandran:
Toward Semantics-Based Answer Pinpointing. HLT 2001
[c45]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/trec/HovyHL01
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/HovyHL01
Eduard H. Hovy, Ulf Hermjakob, Chin-Yew Lin:
The Use of External Knowledge of Factoid QA. TREC 2001
2000
[c44]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/coling/LinH00
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/LinH00
Chin-Yew Lin, Eduard H. Hovy:
The Automated Acquisition of Topic Signatures for Text Summarization. COLING 2000: 495-501
[c43]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/AmbiteAGHHKPRSSW00
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/AmbiteAGHHKPRSSW00
José Luis Ambite, Yigal Arens, Luis Gravano, Vasileios Hatzivassiloglou, Eduard H. Hovy, Judith L. Klavans, Andrew Philpot, Usha Ramachandran, Jay Sandhaus, Anurag Singla, Brian Whitman:
Simplifying data access: the energy data collection (EDC) project. DG.O 2000
[c42]
- view
  - electronic edition @ acm.org
  - no references & citations available
- export record
  dblp key:
  - conf/dgo/HovyK00
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/HovyK00
Eduard H. Hovy, Judith L. Klavans:
The energy data collection project. DG.O 2000
[c41]
- view
  - electronic edition @ ceur-ws.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/ecai/AgirreAHM00
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ecai/AgirreAHM00
Eneko Agirre, Olatz Ansa, Eduard H. Hovy, David Martínez:
Enriching very large ontologies using the WWW. ECAI Workshop on Ontology Learning 2000
[c40]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/trec/HovyGHJL00
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/trec/HovyGHJL00
Eduard H. Hovy, Laurie Gerber, Ulf Hermjakob, Michael Junk, Chin-Yew Lin:
Question Answering in Webclopedia. TREC 2000
1999
[c39]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/mtsummit/KingHTWZ99
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mtsummit/KingHTWZ99
Margaret King, Eduard H. Hovy, Benjamin K. Tsou, John White, Yusoff Zaharin:
MT evaluation. MTSummit 1999: 197-207
1998
[c38]
- view
  authority control:
- export record
  dblp key:
  - conf/amta/GerberH98
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/amta/GerberH98
Laurie Gerber, Eduard H. Hovy:
Improving Translation Quality by Manipulating Sentence Length. AMTA 1998: 448-460
[c37]
- no documents available
  - no references & citations available
- export record
  dblp key:
  - conf/lrec/Hovy98
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/lrec/Hovy98
Eduard H. Hovy:
Combining and standardizing large- scale, practical ontologies for machine tranlation and other uses. LREC 1998: 535-542
[c36]
- view
  authority control:
- export record
  dblp key:
  - conf/tipster/HovyL98
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tipster/HovyL98
Eduard H. Hovy, Chin-Yew Lin:
Automated Text Summarization and the SUMMARIST System. TIPSTER 1998: 197-214
1997
[c35]
- view
  authority control:
- export record
  dblp key:
  - conf/anlp/LinH97
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/anlp/LinH97
Chin-Yew Lin, Eduard H. Hovy:
Identifying Topics by Position. ANLP 1997: 283-290
1996
[c34]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/amta/HovyCGLMNW96
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/amta/HovyCGLMNW96
Eduard H. Hovy, Kenneth Church, Denis Gachot, Marge Leon, Alan K. Melby, Sergei Nirenburg, Yorick Wilks:
Panel: The limits of automation: optimists vs skeptics. AMTA 1996
[c33]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/amta/KnightACHLWY96
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/amta/KnightACHLWY96
Kevin Knight, Yaser Al-Onaizan, Ishwar Chander, Eduard H. Hovy, Irene Langkilde, Richard Whitney, Kenji Yamada:
JAPANGLOSS: using statistics to fill knowledge gaps. AMTA 1996
[c32]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/inlg/DalianisH96
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/inlg/DalianisH96
Hercules Dalianis, Eduard H. Hovy:
On Lexical Aggregation and Ordering. INLG 1996
[c31]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/inlg/WannerH96
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/inlg/WannerH96
Leo Wanner, Eduard H. Hovy:
The HealthDoc Sentence Planner. INLG (1) 1996
1995
[c30]
- view
  - electronic edition @ ijcai.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/ijcai/KnightCHHHILWY95
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcai/KnightCHHHILWY95
Kevin Knight, Ishwar Chander, Matthew Haines, Vasileios Hatzivassiloglou, Eduard H. Hovy, Masayo Iida, Steve K. Luk, Richard Whitney, Kenji Yamada:
Filling Knowledge Gaps in a Broad-Coverage Machine Translation System. IJCAI 1995: 1390-1397
1994
[c29]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/amta/CarbonellFFHHKL94
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/amta/CarbonellFFHHKL94
Jaime G. Carbonell, David Farwell, Robert E. Frederking, Stephen Helmreich, Eduard H. Hovy, Kevin Knight, Lori S. Levin, Sergei Nirenburg:
PANGLOSS. AMTA 1994
[c28]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/amta/ChurchDHNST94
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/amta/ChurchDHNST94
Kenneth Church, Bonnie J. Dorr, Eduard H. Hovy, Sergei Nirenburg, Bernard Scott, Virginia Teller:
Is MT Research Doing Any Good? AMTA 1994
[c27]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/amta/FrederkingNFHHK94
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/amta/FrederkingNFHHK94
Robert E. Frederking, Sergei Nirenburg, David Farwell, Stephen Helmreich, Eduard H. Hovy, Kevin Knight, Stephen Beale, Constantino Domashnev, Donalee Attardo, Dean Grannes, Ralf D. Brown:
Integrating Translations from Multiple Sources within the PANGLOSS Mark III Machine Translation System. AMTA 1994
[c26]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/amta/KnightCHHHILOWY94
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/amta/KnightCHHHILOWY94
Kevin Knight, Ishwar Chander, Matthew Haines, Vasileios Hatzivassiloglou, Eduard H. Hovy, Masayo Iida, Steve K. Luk, Akitoshi Okumura, Richard Whitney, Kenji Yamada:
Integrating Knowledge Bases and Statistics in MT. AMTA 1994
[c25]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/amta/OkumuraH94
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/amta/OkumuraH94
Akitoshi Okumura, Eduard H. Hovy:
Lexicon-to-Ontology Concept Association Using a Bilingual Dictionary. AMTA 1994
[c24]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/inlg/LavidH94
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/inlg/LavidH94
Julia Lavid, Eduard H. Hovy:
Toward a Multidimensional Framework to Guide the Automated Generation of Text Types. INLG 1994
[c23]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/Hovy94
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/Hovy94
Eduard H. Hovy:
Session 4: Machine Translation. HLT 1994
[c22]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/Hovy94a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/Hovy94a
Eduard H. Hovy:
PANGLOSS: Knowledge-Based Machine Translation. HLT 1994
[c21]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/OkumuraH94
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/OkumuraH94
Akitoshi Okumura, Eduard H. Hovy:
Building Japanese-English Dictionary based on Ontology for Machine Translation. HLT 1994
1993
[c20]
- view
  authority control:
- export record
  dblp key:
  - conf/ewnlg/DalianisH93
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ewnlg/DalianisH93
Hercules Dalianis, Eduard H. Hovy:
Aggregation in Natural Language Generation. EWNLG 1993: 88-105
[c19]
- no documents available
  - no references & citations available
- export record
  dblp key:
  - conf/ijcai/ArensHM93
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcai/ArensHM93
Yigal Arens, Eduard H. Hovy, Susanne van Mulken:
Structure and Rules in Automated Multimedia Presentation Planning. IJCAI 1993: 1253-1261
[c18]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/Hovy93
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/Hovy93
Eduard H. Hovy:
The PENMAN Project on Knowledge-Based Machine Translation. HLT 1993
1992
[c17]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/Hovy92
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/Hovy92
Eduard H. Hovy:
In-Depth Knowledge-Based Machine Translation. HLT 1992
[c16]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/HovyN92
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/HovyN92
Eduard H. Hovy, Sergei Nirenburg:
Approximating an Interlingua in a Principled Way. HLT 1992
[c15]
- view
  authority control:
- export record
  dblp key:
  - conf/nlg/HovyLMMP92
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/nlg/HovyLMMP92
Eduard H. Hovy, Julia Lavid, Elisabeth Maier, Vibhu O. Mittal, Cécile Paris:
Employing Knowledge Resources in a New Text Planner Architecture. NLG 1992: 57-72
[c14]
- view
  authority control:
- export record
  dblp key:
  - conf/nlg/HovyKMNR92
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/nlg/HovyKMNR92
Eduard H. Hovy, Richard I. Kittredge, Christian Matthiessen, Sergei Nirenburg, Dietmar F. Rösner:
Multilinguality and Generation. NLG 1992: 293-308
1991
[c13]
- view
  - electronic edition @ aaai.org (archived)
  - no references & citations available
- export record
  dblp key:
  - conf/aaai/HovyA91
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/HovyA91
Eduard H. Hovy, Yigal Arens:
Automatic Generation of Formatted Text. AAAI 1991: 92-97
[c12]
- no documents available
  - no references & citations available
- export record
  dblp key:
  - conf/aaai/ArensHV91
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/ArensHV91
Yigal Arens, Eduard H. Hovy, Mira Vossers:
On the Knowledge Underlying Multimedia Presentations. AAAI Workshop on Intelligent Multimedia Interfaces 1991: 280-306
[c11]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/Hovy91
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/Hovy91
Eduard H. Hovy:
The Penman Natural Language Project Systemics-Based Machine Translation. HLT 1991
1990
[c10]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/inlg/Hovy90
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/inlg/Hovy90
Eduard H. Hovy:
Parsimonious and Profligate Approaches to the Question of Discourse Structure Relations. INLG 1990
[c9]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/KasperH90
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/KasperH90
Robert T. Kasper, Eduard H. Hovy:
Performing Integrated Syntactic and Semantic Parsing Using Classification. HLT 1990
[c8]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/WilksCFHN90
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/WilksCFHN90
Yorick Wilks, Jaime G. Carbonell, David Farwell, Eduard H. Hovy, Sergei Nirenburg:
Machine Translation Again? HLT 1990
1989
[c7]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/Hovy89
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/Hovy89
Eduard H. Hovy:
New Possibilities in Machine Translation. HLT (2) 1989
[c6]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/Hovy89a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/Hovy89a
Eduard H. Hovy:
The Current Status of the Penman Language Generation System. HLT (2) 1989
[c5]
- view
  - electronic edition @ aclanthology.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/naacl/MannH89
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/MannH89
William C. Mann, Eduard H. Hovy:
The Penman Language Generation Project. HLT (1) 1989
1988
[c4]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/Hovy88
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/Hovy88
Eduard H. Hovy:
Planning Coherent Multisentential Text. ACL 1988: 163-169
[c3]
- view
  authority control:
- export record
  dblp key:
  - conf/acl/Hovy88a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/Hovy88a
Eduard H. Hovy:
Two Types of Planning in Language Generation. ACL 1988: 179-186
1987
[c2]
- view
  - electronic edition @ aaai.org (archived)
  - no references & citations available
- export record
  dblp key:
  - conf/aaai/Hovy87
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aaai/Hovy87
Eduard H. Hovy:
Interpretation in Generation. AAAI 1987: 545-549
1985
[c1]
- view
  - electronic edition @ ijcai.org (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/ijcai/Hovy85
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcai/Hovy85
Eduard H. Hovy:
Integrating Text Planning and Production in Generation. IJCAI 1985: 848-851

Parts in Books or Collections

see FAQ

What is the meaning of the colors in the publication lists?

2019
[p8]
- view
  authority control:
- export record
  dblp key:
  - books/sp/19/PenasRMFHSG19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/19/PenasRMFHSG19
Anselmo Peñas, Álvaro Rodrigo, Bernardo Magnini, Pamela Forner, Eduard H. Hovy, Richard F. E. Sutcliffe, Danilo Giampiccolo:
Results and Lessons of the Question Answering Track at CLEF. Information Retrieval Evaluation in a Changing World 2019: 441-460
2013
[p7]
- view
  authority control:
- export record
  dblp key:
  - series/tanlp/OltramariVQH13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/series/tanlp/OltramariVQH13
Alessandro Oltramari, Piek Vossen, Lu Qin, Eduard H. Hovy:
Introduction. New Trends of Research in Ontologies and Lexical Resources 2013: 1-3
2011
[p6]
- view
  authority control:
- export record
  dblp key:
  - series/tanlp/HovyOR11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/series/tanlp/HovyOR11
Eduard H. Hovy, Jon Oberlander, Norbert Reithinger:
IMIX: Good Questions, Promising Answers. Interactive Multi-modal Question-Answering 2011: 271-279
2008
[p5]
- view
  authority control:
- export record
  dblp key:
  - books/sp/08/Hovy08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/08/Hovy08
Eduard H. Hovy:
An Outline for the Foundations of Digital Government Research. Digital Government 2008: 43-59
[p4]
- view
  authority control:
- export record
  dblp key:
  - books/sp/08/Hovy08a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/08/Hovy08a
Eduard H. Hovy:
Data and Knowledge Integration for e-Government. Digital Government 2008: 219-231
[p3]
- view
  authority control:
- export record
  dblp key:
  - series/sci/BurnsFH08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/series/sci/BurnsFH08
Gully Burns, Donghui Feng, Eduard H. Hovy:
Intelligent Approaches to Mining the Primary Research Literature: Techniques, Systems, and Examples. Computational Intelligence in Medical Informatics 2008: 17-50
2005
[p2]
- no documents available
  - no references & citations available
- export record
  dblp key:
  - books/ox/05/FilatovaH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/ox/05/FilatovaH05
Elena Filatova, Eduard H. Hovy:
Assigning Time-Stamps to Event-Clauses. The Language of Time - A Reader 2005: 523-532
2002
[p1]
- view
  authority control:
- export record
  dblp key:
  - series/ads/AmbiteABFGHHKPRRSSSSSTWZ02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/series/ads/AmbiteABFGHHKPRRSSSSSTWZ02
José Luis Ambite, Yigal Arens, Walter Bourne, Steven Feiner, Luis Gravano, Vasileios Hatzivassiloglou, Eduard H. Hovy, Judith Klavans, Andrew Philpot, Usha Ramachandran, Kenneth A. Ross, Jay Sandhaus, Deniz Sariöz, Rolfe R. Schmidt, Cyrus Shahabi, Anurag Singla, Surabhan Temiyabutr, Brian Whitman, Kazi A. Zaman:
Data Integration and Access - The Digital Government Research Center's Energy Data Collection (EDC) Project. Advances in Digital Government 2002: 85-106

Editorship

see FAQ

What is the meaning of the colors in the publication lists?

2020
[e17]
- view
- export record
  dblp key:
  - conf/emnlp/2020sdp
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/emnlp/2020sdp
Muthu Kumar Chandrasekaran, Anita de Waard, Guy Feigenblat, Dayne Freitag, Tirthankar Ghosal, Eduard H. Hovy, Petr Knoth, David Konopnicki, Philipp Mayr, Robert M. Patton, Michal Shmueli-Scheuer:
Proceedings of the First Workshop on Scholarly Document Processing, SDP@EMNLP 2020, Online, November 19, 2020. Association for Computational Linguistics 2020, ISBN 978-1-952148-70-5 [contents]
[e16]
- view
- export record
  dblp key:
  - conf/eval4nlp/2020
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/eval4nlp/2020
Steffen Eger, Yang Gao, Maxime Peyrard, Wei Zhao, Eduard H. Hovy:
Proceedings of the First Workshop on Evaluation and Comparison of NLP Systems, Eval4NLP 2020, Online, November 20, 2020. Association for Computational Linguistics 2020, ISBN 978-1-952148-82-8 [contents]
2018
[e15]
- view
- export record
  dblp key:
  - conf/coling/2018eventstory
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/coling/2018eventstory
Tommaso Caselli, Ben Miller, Marieke van Erp, Piek Vossen, Martha Palmer, Eduard H. Hovy, Teruko Mitamura, David Caswell, Susan Windisch Brown, Claire Bonial:
Proceedings of the Workshop Events and Stories in the News, EventStory@Coling 2018, Santa Fe, New Mexico, USA, August 20, 2018. Association for Computational Linguistics 2018, ISBN 978-1-948087-59-9 [contents]
[e14]
- view
- export record
  dblp key:
  - conf/textgraphs/2018
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/textgraphs/2018
Goran Glavas, Swapna Somasundaran, Martin Riedl, Eduard H. Hovy:
Proceedings of the Twelfth Workshop on Graph-Based Methods for Natural Language Processing, TextGraphs@NAACL-HLT 2018, New Orleans, Louisiana, USA, June 6, 2018. Association for Computational Linguistics 2018, ISBN 978-1-948087-25-4 [contents]
2017
[e13]
- view
- export record
  dblp key:
  - conf/acl/2017news
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/acl/2017news
Tommaso Caselli, Ben Miller, Marieke van Erp, Piek Vossen, Martha Palmer, Eduard H. Hovy, Teruko Mitamura, David Caswell:
Proceedings of the Events and Stories in the News Workshop@ACL 2017, Vancouver, Canada, August 4, 2017. Association for Computational Linguistics 2017, ISBN 978-1-945626-63-0 [contents]
[e12]
- view
- export record
  dblp key:
  - conf/textgraphs/2017
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/textgraphs/2017
Martin Riedl, Swapna Somasundaran, Goran Glavas, Eduard H. Hovy:
Proceedings of TextGraphs@ACL 2017: the 11th Workshop on Graph-based Methods for Natural Language Processing, Vancouver, Canada, August 3, 2017. Association for Computational Linguistics 2017, ISBN 978-1-945626-60-9 [contents]
2016
[e11]
- view
- export record
  dblp key:
  - conf/aclevents/2016
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aclevents/2016
Martha Palmer, Eduard H. Hovy, Teruko Mitamura, Tim O'Gorman:
Proceedings of the Fourth Workshop on Events, EVENTS@HLT-NAACL 2016, San Diego, California, USA, June 17, 2016. Association for Computational Linguistics 2016, ISBN 978-1-941643-89-1 [contents]
2015
[e10]
- view
- export record
  dblp key:
  - conf/aclevents/2015
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aclevents/2015
Eduard H. Hovy, Teruko Mitamura, Martha Palmer:
Proceedings of the The 3rd Workshop on EVENTS: Definition, Detection, Coreference, and Representation, EVENTS@HLP-NAACL 2015, Denver, Colorado, USA, June 4, 2015. Association for Computational Linguistics 2015, ISBN 978-1-941643-37-2 [contents]
2014
[e9]
- view
- export record
  dblp key:
  - conf/aclevents/2014
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/aclevents/2014
Teruko Mitamura, Eduard H. Hovy, Martha Palmer:
Proceedings of the Second Workshop on EVENTS: Definition, Detection, Coreference, and Representation, EVENTS@ACL 2014, Baltimore, Maryland, USA, June 2014. Association for Computational Linguistics 2014, ISBN 978-1-941643-14-3 [contents]
2013
[e8]
- view
- export record
  dblp key:
  - conf/naacl/2013events
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/naacl/2013events
Eduard H. Hovy, Teruko Mitamura, Martha Palmer:
Workshop on Events: Definition, Detection, Coreference, and Representation, EVENTS@NAACL-HLT 2013, Atlanta, Georgia, USA, June 14, 2013. Association for Computational Linguistics 2013, ISBN 978-1-937284-47-3 [contents]
[e7]
- view
  authority control:
- export record
  dblp key:
  - series/tanlp/OVQH2013
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/series/tanlp/OVQH2013
Alessandro Oltramari, Piek Vossen, Lu Qin, Eduard H. Hovy:
New Trends of Research in Ontologies and Lexical Resources, Ideas, Projects, Systems. Theory and Applications of Natural Language Processing, Springer 2013, ISBN 978-3-642-31781-1 [contents]
2008
[e6]
- view
  authority control:
- export record
  dblp key:
  - books/sp/08/CBGTDHM2008
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/08/CBGTDHM2008
Hsinchun Chen, Lawrence Brandt, Valerie Gregg, Roland Traunmüller, Sharon S. Dawes, Eduard H. Hovy, Ann Macintosh, Catherine A. Larson:
Digital Government: E-Government Research, Case Studies, and Implementation. Integrated Series In Information Systems 17, Springer 2008, ISBN 978-0-387-71610-7 [contents]
2004
[e5]
- view
- export record
  dblp key:
  - conf/dgo/2004
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/2004
Sharon S. Dawes, Eduard H. Hovy, Lois M. L. Delcambre:
Proceedings of the 2004 Annual National Conference on Digital Government Research, DG.O 2004, Seattle, WA, USA, 2004. ACM International Conference Proceeding Series, Digital Government Research Center 2004 [contents]
2003
[e4]
- view
- export record
  dblp key:
  - conf/dgo/2003
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dgo/2003
Yigal Arens, Eduard H. Hovy, Peggy Agouris:
Proceedings of the 2003 Annual National Conference on Digital Government Research, DG.O 2003, Boston, MA, USA, 2003. ACM International Conference Proceeding Series, Digital Government Research Center 2003 [contents]
2001
[e3]
- view
- export record
  dblp key:
  - conf/ijcai/2001ol
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ijcai/2001ol
Alexander Maedche, Steffen Staab, Claire Nedellec, Eduard H. Hovy:
IJCAI'2001 Workshop on Ontology Learning, Proceedings of the Second Workshop on Ontology Learning OL'2001, Seattle, USA, August 4, 2001 (Held in conjunction with the 17th International Conference on Artificial Intelligence IJCAI'2001). CEUR Workshop Proceedings 38, CEUR-WS.org 2001 [contents]
1998
[e2]
- view
  authority control:
- export record
  dblp key:
  - conf/amta/1998
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/amta/1998
David Farwell, Laurie Gerber, Eduard H. Hovy:
Machine Translation and the Information Soup, Third Conference of the Association for Machine Translation in the Americas, AMTA '98, Langhorne, PA, USA, October 28-31, 1998, Proceedings. Lecture Notes in Computer Science 1529, Springer 1998, ISBN 3-540-65259-0 [contents]
1992
[e1]
- view
  authority control:
- export record
  dblp key:
  - conf/nlg/1992
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/nlg/1992
Robert Dale, Eduard H. Hovy, Dietmar F. Rösner, Oliviero Stock:
Aspects of Automated Natural Language Generation, 6th International Workshop on Natural Language Generation, Trento, Italy, April 5-7, 1992, Proceedings. Lecture Notes in Computer Science 587, Springer 1992, ISBN 3-540-55399-1 [contents]

Informal and Other Publications

see FAQ

What is the meaning of the colors in the publication lists?

2024
[i127]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2402-18005
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2402-18005
Miao Li, Jey Han Lau, Eduard H. Hovy:
Exploring Multi-Document Information Consolidation for Scientific Sentiment Summarization. CoRR abs/2402.18005 (2024)
2023
[i126]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2305-01498
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2305-01498
Miao Li, Eduard H. Hovy, Jey Han Lau:
Towards Summarizing Multiple Documents with Hierarchical Relationships. CoRR abs/2305.01498 (2023)
[i125]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2305-08414
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2305-08414
Simone Tedeschi, Johan Bos, Thierry Declerck, Jan Hajic, Daniel Hershcovich, Eduard H. Hovy, Alexander Koller, Simon Krek, Steven Schockaert, Rico Sennrich, Ekaterina Shutova, Roberto Navigli:
What's the Meaning of Superhuman Performance in Today's NLU? CoRR abs/2305.08414 (2023)
[i124]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2305-12634
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2305-12634
Zhisong Zhang, Emma Strubell, Eduard H. Hovy:
Data-efficient Active Learning for Structured Prediction with Partial Annotation and Self-Training. CoRR abs/2305.12634 (2023)
[i123]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2310-05189
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2310-05189
Isabelle Augenstein, Timothy Baldwin, Meeyoung Cha, Tanmoy Chakraborty, Giovanni Luca Ciampaglia, David P. A. Corney, Renee DiResta, Emilio Ferrara, Scott Hale, Alon Y. Halevy, Eduard H. Hovy, Heng Ji, Filippo Menczer, Rubén Míguez, Preslav Nakov, Dietram Scheufele, Shivam Sharma, Giovanni Zagni:
Factuality Challenges in the Era of Large Language Models. CoRR abs/2310.05189 (2023)
[i122]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2310-20633
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2310-20633
Sha Li, Chi Han, Pengfei Yu, Carl Edwards, Manling Li, Xingyao Wang, Yi R. Fung, Charles Yu, Joel R. Tetreault, Eduard H. Hovy, Heng Ji:
Defining a New NLP Playground. CoRR abs/2310.20633 (2023)
[i121]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2312-05603
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2312-05603
Shuhe Wang, Beiming Cao, Shengyu Zhang, Xiaoya Li, Jiwei Li, Fei Wu, Guoyin Wang, Eduard H. Hovy:
Sim-GPT: Text Similarity via GPT Annotated Data. CoRR abs/2312.05603 (2023)
2022
[i120]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2205-12416
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2205-12416
Dheeraj Rajagopal, Siamak Shakeri, Cícero Nogueira dos Santos, Eduard H. Hovy, Chung-Ching Chang:
Counterfactual Data Augmentation improves Factuality of Abstractive Summarization. CoRR abs/2205.12416 (2022)
[i119]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2209-06275
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2209-06275
Sedrick Scott Keh, Steven Y. Feng, Varun Gangal, Malihe Alikhani, Eduard H. Hovy:
PANCETTA: Phoneme Aware Neural Completion to Elicit Tongue Twisters Automatically. CoRR abs/2209.06275 (2022)
[i118]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2209-07752
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2209-07752
Sedrick Scott Keh, Kevin Lu, Varun Gangal, Steven Y. Feng, Harsh Jhamtani, Malihe Alikhani, Eduard H. Hovy:
PINEAPPLE: Personifying INanimate Entities by Acquiring Parallel Personification data for Learning Enhanced generation. CoRR abs/2209.07752 (2022)
[i117]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2210-04191
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2210-04191
Steven Y. Feng, Vivek Khetan, Bogdan Sacaleanu, Anatole Gershman, Eduard H. Hovy:
CHARD: Clinical Health-Aware Reasoning Across Dimensions for Text Generation Models. CoRR abs/2210.04191 (2022)
[i116]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2210-10109
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2210-10109
Zhisong Zhang, Emma Strubell, Eduard H. Hovy:
A Survey of Active Learning for Natural Language Processing. CoRR abs/2210.10109 (2022)
[i115]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2211-05392
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2211-05392
Evangelia Spiliopoulou, Artidoro Pagnoni, Yonatan Bisk, Eduard H. Hovy:
EvEntS ReaLM: Event Reasoning of Entity States via Language Models. CoRR abs/2211.05392 (2022)
2021
[i114]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2102-01017
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2102-01017
Yanai Elazar, Nora Kassner, Shauli Ravfogel, Abhilasha Ravichander, Eduard H. Hovy, Hinrich Schütze, Yoav Goldberg:
Measuring and Improving Consistency in Pretrained Language Models. CoRR abs/2102.01017 (2021)
[i113]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2102-08345
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2102-08345
Abhilasha Ravichander, Siddharth Dalmia, Maria Ryskina, Florian Metze, Eduard H. Hovy, Alan W. Black:
NoiseQA: Challenge Set Evaluation for User-Centric Question Answering. CoRR abs/2102.08345 (2021)
[i112]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2103-12279
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2103-12279
Dheeraj Rajagopal, Vidhisha Balachandran, Eduard H. Hovy, Yulia Tsvetkov:
SelfExplain: A Self-Explaining Architecture for Neural Text Classifiers. CoRR abs/2103.12279 (2021)
[i111]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2104-00814
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2104-00814
Dheeraj Rajagopal, Aman Madaan, Niket Tandon, Yiming Yang, Shrimai Prabhumoye, Abhilasha Ravichander, Peter Clark, Eduard H. Hovy:
CURIE: An Iterative Querying Approach for Reasoning About Situations. CoRR abs/2104.00814 (2021)
[i110]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2104-05196
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2104-05196
Yiwei Lyu, Paul Pu Liang, Hai Pham, Eduard H. Hovy, Barnabás Póczos, Ruslan Salakhutdinov, Louis-Philippe Morency:
StylePTB: A Compositional Benchmark for Fine-grained Controllable Text Style Transfer. CoRR abs/2104.05196 (2021)
[i109]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2104-06669
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2104-06669
Varun Gangal, Steven Y. Feng, Eduard H. Hovy, Teruko Mitamura:
NAREOR: The Narrative Reordering Problem. CoRR abs/2104.06669 (2021)
[i108]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2104-08765
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2104-08765
Aman Madaan, Niket Tandon, Dheeraj Rajagopal, Yiming Yang, Peter Clark, Keisuke Sakaguchi, Eduard H. Hovy:
Improving Neural Model Performance through Natural Language Feedback on Their Explanations. CoRR abs/2104.08765 (2021)
[i107]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2105-03075
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2105-03075
Steven Y. Feng, Varun Gangal, Jason Wei, Sarath Chandar, Soroush Vosoughi, Teruko Mitamura, Eduard H. Hovy:
A Survey of Data Augmentation Approaches for NLP. CoRR abs/2105.03075 (2021)
[i106]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2105-05418
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2105-05418
Aman Madaan, Dheeraj Rajagopal, Niket Tandon, Yiming Yang, Eduard H. Hovy:
Could you give me a hint? Generating inference graphs for defeasible reasoning. CoRR abs/2105.05418 (2021)
[i105]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2105-07571
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2105-07571
Yohan Jo, Seojin Bang, Chris Reed, Eduard H. Hovy:
Classifying Argumentative Relations Using Logical Mechanisms and Argumentation Schemes. CoRR abs/2105.07571 (2021)
[i104]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2106-01269
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2106-01269
Rishabh Bhardwaj, Navonil Majumder, Soujanya Poria, Eduard H. Hovy:
More Identifiable yet Equally Performant Transformers for Text Classification. CoRR abs/2106.01269 (2021)
[i103]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2106-02833
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2106-02833
Varun Gangal, Harsh Jhamtani, Eduard H. Hovy, Taylor Berg-Kirkpatrick:
Improving Automated Evaluation of Open Domain Dialog via Diverse Reference Augmentation. CoRR abs/2106.02833 (2021)
[i102]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2106-12698
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2106-12698
Maria Ryskina, Eduard H. Hovy, Taylor Berg-Kirkpatrick, Matthew R. Gormley:
Comparative Error Analysis in Neural and Finite-state Models for Unsupervised Character-level Transduction. CoRR abs/2106.12698 (2021)
[i101]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2108-06643
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2108-06643
Steven Y. Feng, Jessica Huynh, Chaitanya Narisetty, Eduard H. Hovy, Varun Gangal:
SAPPHIRE: Approaches for Enhanced Concept-to-Text Generation. CoRR abs/2108.06643 (2021)
[i100]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2109-03892
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2109-03892
Steven Y. Feng, Kevin Lu, Zhuofu Tao, Malihe Alikhani, Teruko Mitamura, Eduard H. Hovy, Varun Gangal:
Retrieve, Caption, Generate: Visual Grounding for Enhancing Commonsense in Text Generation Models. CoRR abs/2109.03892 (2021)
[i99]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2109-09057
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2109-09057
Yohan Jo, Haneul Yoo, JinYeong Bak, Alice Oh, Chris Reed, Eduard H. Hovy:
Knowledge-Enhanced Evidence Retrieval for Counterargument Generation. CoRR abs/2109.09057 (2021)
[i98]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2110-00687
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2110-00687
Harsh Jhamtani, Varun Gangal, Eduard H. Hovy, Taylor Berg-Kirkpatrick:
Investigating Robustness of Dialog Models to Popular Figurative Language Constructs. CoRR abs/2110.00687 (2021)
[i97]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2110-10470
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2110-10470
Xiaofei Sun, Diyi Yang, Xiaoya Li, Tianwei Zhang, Yuxian Meng, Han Qiu, Guoyin Wang, Eduard H. Hovy, Jiwei Li:
Interpreting Deep Learning Models in Natural Language Processing: A Review. CoRR abs/2110.10470 (2021)
[i96]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2110-12349
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2110-12349
Aman Madaan, Niket Tandon, Dheeraj Rajagopal, Peter Clark, Yiming Yang, Eduard H. Hovy:
Think about it! Improving defeasible reasoning by first modeling the question scenario. CoRR abs/2110.12349 (2021)
[i95]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2111-00539
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2111-00539
Dheeraj Rajagopal, Vivek Khetan, Bogdan Sacaleanu, Anatole Gershman, Andrew E. Fano, Eduard H. Hovy:
Cross-Domain Reasoning via Template Filling. CoRR abs/2111.00539 (2021)
[i94]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2112-02721
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2112-02721
Kaustubh D. Dhole, Varun Gangal, Sebastian Gehrmann, Aadesh Gupta, Zhenhao Li, Saad Mahamood, Abinaya Mahendiran, Simon Mille, Ashish Srivastava, Samson Tan, Tongshuang Wu, Jascha Sohl-Dickstein, Jinho D. Choi, Eduard H. Hovy, Ondrej Dusek, Sebastian Ruder, Sajant Anand, Nagender Aneja, Rabin Banjade, Lisa Barthe, Hanna Behnke, Ian Berlot-Attwell, Connor Boyle, Caroline Brun, Marco Antonio Sobrevilla Cabezudo, Samuel Cahyawijaya, Emile Chapuis, Wanxiang Che, Mukund Choudhary, Christian Clauss, Pierre Colombo, Filip Cornell, Gautier Dagan, Mayukh Das, Tanay Dixit, Thomas Dopierre, Paul-Alexis Dray, Suchitra Dubey, Tatiana Ekeinhor, Marco Di Giovanni, Rishabh Gupta, Rishabh Gupta, Louanes Hamla, Sang Han, Fabrice Harel-Canada, Antoine Honore, Ishan Jindal, Przemyslaw K. Joniak, Denis Kleyko, Venelin Kovatchev, et al.:
NL-Augmenter: A Framework for Task-Sensitive Natural Language Augmentation. CoRR abs/2112.02721 (2021)
2020
[i93]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2004-11820
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2004-11820
Xuezhe Ma, Xiang Kong, Shanghang Zhang, Eduard H. Hovy:
Decoupling Global and Local Representations from/for Image Generation. CoRR abs/2004.11820 (2020)
[i92]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2004-12934
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2004-12934
Xiang Kong, Varun Gangal, Eduard H. Hovy:
SCDE: Sentence Cloze Dataset with High Quality Distractors From Examinations. CoRR abs/2004.12934 (2020)
[i91]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2005-00719
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2005-00719
Abhilasha Ravichander, Yonatan Belinkov, Eduard H. Hovy:
Probing the Probing Paradigm: Does Probing Accuracy Entail Task Relevance? CoRR abs/2005.00719 (2020)
[i90]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2005-01526
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2005-01526
Dheeraj Rajagopal, Niket Tandon, Peter Clark, Bhavana Dalvi, Eduard H. Hovy:
What-if I ask you to explain: Explaining the effects of perturbations in procedural text. CoRR abs/2005.01526 (2020)
[i89]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2006-07425
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2006-07425
Shi Zong, Alan Ritter, Eduard H. Hovy:
Measuring Forecasting Skill from Text. CoRR abs/2006.07425 (2020)
[i88]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2010-01794
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2010-01794
Steven Y. Feng, Varun Gangal, Dongyeop Kang, Teruko Mitamura, Eduard H. Hovy:
GenAug: Data Augmentation for Finetuning Text Generators. CoRR abs/2010.01794 (2020)
[i87]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2010-02114
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2010-02114
Divyansh Kaushik, Amrith Setlur, Eduard H. Hovy, Zachary C. Lipton:
Explaining The Efficacy of Counterfactually-Augmented Data. CoRR abs/2010.02114 (2020)
[i86]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2010-02654
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2010-02654
Yohan Jo, Jacky Visser, Chris Reed, Eduard H. Hovy:
Extracting Implicitly Asserted Propositions in Argumentation. CoRR abs/2010.02654 (2020)
[i85]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2010-02660
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2010-02660
Yohan Jo, Seojin Bang, Emaad A. Manzoor, Eduard H. Hovy, Chris Reed:
Detecting Attackable Sentences in Arguments. CoRR abs/2010.02660 (2020)
[i84]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2010-04098
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2010-04098
Varun Gangal, Eduard H. Hovy:
BERTering RAMS: What and How Much does BERT Already Know About Event Arguments? - A Study on the RAMS Dataset. CoRR abs/2010.04098 (2020)
[i83]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2010-05141
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2010-05141
Dongyeop Kang, Eduard H. Hovy:
Plan ahead: Self-Supervised Text Planning for Paragraph Completion Task. CoRR abs/2010.05141 (2020)
[i82]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2010-06943
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2010-06943
Yuxian Meng, Chun Fan, Zijun Sun, Eduard H. Hovy, Fei Wu, Jiwei Li:
Pair the Dots: Jointly Examining Training History and Test Stimuli for Model Interpretability. CoRR abs/2010.06943 (2020)
[i81]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2010-11764
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2010-11764
Aman Madaan, Dheeraj Rajagopal, Yiming Yang, Abhilasha Ravichander, Eduard H. Hovy, Shrimai Prabhumoye:
EIGEN: Event Influence GENeration using Pre-trained Language Models. CoRR abs/2010.11764 (2020)
[i80]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2011-00681
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2011-00681
Evangelia Spiliopoulou, Salvador Medina Maza, Eduard H. Hovy, Alexander G. Hauptmann:
Event-Related Bias Removal for Real-time Disaster Events. CoRR abs/2011.00681 (2020)
[i79]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2011-06132
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2011-06132
Xiang Kong, Zhisong Zhang, Eduard H. Hovy:
Incorporating a Local Translation Mechanism into Non-autoregressive Translation. CoRR abs/2011.06132 (2020)
[i78]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2011-08092
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2011-08092
Niket Tandon, Keisuke Sakaguchi, Bhavana Dalvi Mishra, Dheeraj Rajagopal, Peter Clark, Michal Guerquin, Kyle Richardson, Eduard H. Hovy:
A Dataset for Tracking Entities in Open Domain Procedural Text. CoRR abs/2011.08092 (2020)
[i77]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-2011-08951
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2011-08951
Andrew Runge, Eduard H. Hovy:
Exploring Neural Entity Representations for Semantic Information. CoRR abs/2011.08951 (2020)
2019
[i76]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/tac/HovyCCGHMMSDCCK19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tac/HovyCCGHMMSDCCK19
Eduard H. Hovy, Jaime G. Carbonell, Hans Chalupsky, Anatole Gershman, Alex Hauptmann, Florian Metze, Teruko Mitamura, Zaid Sheikh, Ankit Dangi, Aditi Chaudhary, Xianyang Chen, Xiang Kong, Bernie Huang, Salvador Medina, Hector Liu, Xuezhe Ma, Maria Ryskina, Ramon Sanabria, Varun Gangal:
OPERA: Operations-oriented Probabilistic Extraction, Reasoning, and Analysis. TAC 2019
[i75]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1901-01498
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1901-01498
Xuezhe Ma, Chunting Zhou, Eduard H. Hovy:
MAE: Mutual Posterior-Divergence Regularization for Variational AutoEncoders. CoRR abs/1901.01498 (2019)
[i74]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1901-03735
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1901-03735
Abhilasha Ravichander, Aakanksha Naik, Carolyn P. Rosé, Eduard H. Hovy:
EQUATE: A Benchmark Evaluation Framework for Quantitative Reasoning in Natural Language Inference. CoRR abs/1901.03735 (2019)
[i73]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1901-07129
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1901-07129
Xiang Kong, Bohan Li, Graham Neubig, Eduard H. Hovy, Yiming Yang:
An Adversarial Approach to High-Quality, Sentiment-Controlled Neural Dialogue Generation. CoRR abs/1901.07129 (2019)
[i72]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1902-04208
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1902-04208
Xuezhe Ma, Eduard H. Hovy:
MaCow: Masked Convolutional Generative Flow. CoRR abs/1902.04208 (2019)
[i71]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1902-08899
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1902-08899
Aditi Chaudhary, Siddharth Dalmia, Junjie Hu, Xinjian Li, Austin Matthews, Aldrian Obaja Muis, Naoki Otani, Shruti Rijhwani, Zaid Sheikh, Nidhi Vyas, Xinyi Wang, Jiateng Xie, Ruochen Xu, Chunting Zhou, Peter J. Jansen, Yiming Yang, Lori S. Levin, Florian Metze, Teruko Mitamura, David R. Mortensen, Graham Neubig, Eduard H. Hovy, Alan W. Black, Jaime G. Carbonell, Graham Horwood, Shabnam Tafreshi, Mona T. Diab, Efsun Sarioglu Kayi, Noura Farra, Kathleen R. McKeown:
The ARIEL-CMU Systems for LoReHLT18. CoRR abs/1902.08899 (2019)
[i70]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1904-12848
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1904-12848
Qizhe Xie, Zihang Dai, Eduard H. Hovy, Minh-Thang Luong, Quoc V. Le:
Unsupervised Data Augmentation. CoRR abs/1904.12848 (2019)
[i69]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1905-02947
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1905-02947
Soujanya Poria, Navonil Majumder, Rada Mihalcea, Eduard H. Hovy:
Emotion Recognition in Conversation: Research Challenges, Datasets, and Recent Advances. CoRR abs/1905.02947 (2019)
[i68]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1908-11723
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1908-11723
Taehee Jung, Dongyeop Kang, Lucas Mentch, Eduard H. Hovy:
Earlier Isn't Always Better: Sub-aspect Analysis on Corpus and System Biases in Summarization. CoRR abs/1908.11723 (2019)
[i67]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1908-11790
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1908-11790
Dongyeop Kang, Hiroaki Hayashi, Alan W. Black, Eduard H. Hovy:
Linguistic Versus Latent Relations for Modeling Coherent Flow in Paragraphs. CoRR abs/1908.11790 (2019)
[i66]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1909-00098
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1909-00098
Dongyeop Kang, Varun Gangal, Eduard H. Hovy:
(Male, Bachelor) and (Female, Ph.D) have different connotations: Parallelly Annotated Stylistic Language Dataset with Multiple Personas. CoRR abs/1909.00098 (2019)
[i65]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1909-02250
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1909-02250
Takashi Shibuya, Eduard H. Hovy:
Nested Named Entity Recognition via Second-best Sequence Learning and Decoding. CoRR abs/1909.02250 (2019)
[i64]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1909-02480
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1909-02480
Xuezhe Ma, Chunting Zhou, Xian Li, Graham Neubig, Eduard H. Hovy:
FlowSeq: Non-Autoregressive Conditional Sequence Generation with Generative Flow. CoRR abs/1909.02480 (2019)
[i63]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1909-04793
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1909-04793
Evangelia Spiliopoulou, Eduard H. Hovy:
Definition Frames: Using Definitions for Hybrid Concept Representations. CoRR abs/1909.04793 (2019)
[i62]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1909-12434
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1909-12434
Divyansh Kaushik, Eduard H. Hovy, Zachary C. Lipton:
Learning the Difference that Makes a Difference with Counterfactually-Augmented Data. CoRR abs/1909.12434 (2019)
[i61]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1910-12203
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1910-12203
Vaibhav Vaibhav, Raghuram Mandyam Annasamy, Eduard H. Hovy:
Do Sentence Interactions Matter? Leveraging Sentence Level Representations for Fake News Classification. CoRR abs/1910.12203 (2019)
[i60]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1911-03663
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1911-03663
Dongyeop Kang, Eduard H. Hovy:
xSLUE: A Benchmark and Analysis Platform for Cross-Style Language Understanding and Evaluation. CoRR abs/1911.03663 (2019)
[i59]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1911-04053
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1911-04053
Xiang Kong, Xianyang Chen, Eduard H. Hovy:
Decompressing Knowledge Graph Representations for Link Prediction. CoRR abs/1911.04053 (2019)
[i58]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1911-04252
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1911-04252
Qizhe Xie, Eduard H. Hovy, Minh-Thang Luong, Quoc V. Le:
Self-training with Noisy Student improves ImageNet classification. CoRR abs/1911.04252 (2019)
2018
[i57]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/tac/HovyBCCGHMMCCHL18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tac/HovyBCCGHMMCCHL18
Eduard H. Hovy, Taylor Berg-Kirkpatrick, Jaime G. Carbonell, Hans Chalupsky, Anatole Gershman, Alexander G. Hauptmann, Florian Metze, Teruko Mitamura, Aditi Chaudhary, Xianyang Chen, Bernie Po-Yao Huang, Hector Zhengzhong Liu, Xuezhe Ma, Shruti Palaskar, Dheeraj Rajagopal, Maria Ryskina, Ramon Sanabria:
OPERA: Operations-oriented Probabilistic Extraction, Reasoning, and Analysis. TAC 2018
[i56]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1804-09635
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1804-09635
Dongyeop Kang, Waleed Ammar, Bhavana Dalvi, Madeleine van Zuylen, Sebastian Kohlmeier, Eduard H. Hovy, Roy Schwartz:
A Dataset of Peer Reviews (PeerRead): Collection, Insights and NLP Applications. CoRR abs/1804.09635 (2018)
[i55]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1804-10974
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1804-10974
Zihang Dai, Qizhe Xie, Eduard H. Hovy:
From Credit Assignment to Entropy Regularization: Two New Algorithms for Neural Sequence Prediction. CoRR abs/1804.10974 (2018)
[i54]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1805-01087
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1805-01087
Xuezhe Ma, Zecong Hu, Jingzhou Liu, Nanyun Peng, Graham Neubig, Eduard H. Hovy:
Stack-Pointer Networks for Dependency Parsing. CoRR abs/1805.01087 (2018)
[i53]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1805-04680
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1805-04680
Dongyeop Kang, Tushar Khot, Ashish Sabharwal, Eduard H. Hovy:
AdvEntuRe: Adversarial Training for Textual Entailment with Knowledge-Guided Examples. CoRR abs/1805.04680 (2018)
[i52]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1806-05099
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1806-05099
Zhengzhong Liu, Teruko Mitamura, Eduard H. Hovy:
Graph-Based Decoding for Event Sequencing and Coreference Resolution. CoRR abs/1806.05099 (2018)
[i51]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1809-00647
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1809-00647
Zhengzhong Liu, Chenyan Xiong, Teruko Mitamura, Eduard H. Hovy:
Automatic Event Salience Identification. CoRR abs/1809.00647 (2018)
[i50]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1809-09296
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1809-09296
Xiang Kong, Qizhe Xie, Zihang Dai, Eduard H. Hovy:
Fast and Simple Mixture of Softmaxes with BPE and Hybrid-LightRNN for Language Generation. CoRR abs/1809.09296 (2018)
[i49]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1810-00782
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1810-00782
Filip Ilievski, Eduard H. Hovy, Qizhe Xie, Piek Vossen:
The Profiling Machine: Active Generalization over Knowledge. CoRR abs/1810.00782 (2018)
[i48]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1811-00570
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1811-00570
Wasi Uddin Ahmad, Zhisong Zhang, Xuezhe Ma, Eduard H. Hovy, Kai-Wei Chang, Nanyun Peng:
Near or Far, Wide Range Zero-Shot Cross-Lingual Dependency Parsing. CoRR abs/1811.00570 (2018)
[i47]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1811-05546
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1811-05546
Mrinmaya Sachan, Kumar Avinava Dubey, Eduard H. Hovy, Tom M. Mitchell, Dan Roth, Eric P. Xing:
Discourse in Multimedia: A Case Study in Information Extraction. CoRR abs/1811.05546 (2018)
[i46]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1811-08541
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1811-08541
Xiang Kong, Zhaopeng Tu, Shuming Shi, Eduard H. Hovy, Tong Zhang:
Neural Machine Translation with Adequacy-Oriented Learning. CoRR abs/1811.08541 (2018)
2017
[i45]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/tac/ChalupskyAHHLMS17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tac/ChalupskyAHHLMS17
Hans Chalupsky, Jun Araki, Eduard H. Hovy, Andrew Hsi, Zhengzhong Liu, Xuezhe Ma, Evangelia Spiliopoulou, Shuxin Yao:
Multi-lingual Extraction and Integration of Entities, Relations, Events and Sentiments into ColdStart++ KBs with the SAFT System. TAC 2017
[i44]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/tac/MaFLH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tac/MaFLH17
Xuezhe Ma, Nicolas R. Fauceglia, Yiu-Chang Lin, Eduard H. Hovy:
CMU System for Entity Discovery and Linking at TAC-KBP 2017. TAC 2017
[i43]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/tac/MitamuraLH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tac/MitamuraLH17
Teruko Mitamura, Zhengzhong Liu, Eduard H. Hovy:
Events Detection, Coreference and Sequencing: What's next? Overview of the TAC KBP 2017 Event Track. TAC 2017
[i42]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/MaH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/MaH17
Xuezhe Ma, Eduard H. Hovy:
Neural Probabilistic Model for Non-projective MST Parsing. CoRR abs/1701.00874 (2017)
[i41]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/DaiABHC17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/DaiABHC17
Zihang Dai, Amjad Almahairi, Philip Bachman, Eduard H. Hovy, Aaron C. Courville:
Calibrating Energy-based Generative Adversarial Networks. CoRR abs/1702.01691 (2017)
[i40]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/DasigiBHW17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/DasigiBHW17
Pradeep Dasigi, Gully A. P. C. Burns, Eduard H. Hovy, Anita de Waard:
Experiment Segmentation in Scientific Discourse as Clause-level Structured Prediction using Recurrent Neural Networks. CoRR abs/1702.05398 (2017)
[i39]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/LaiXLYH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/LaiXLYH17
Guokun Lai, Qizhe Xie, Hanxiao Liu, Yiming Yang, Eduard H. Hovy:
RACE: Large-scale ReAding Comprehension Dataset From Examinations. CoRR abs/1704.04683 (2017)
[i38]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/XieMDH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/XieMDH17
Qizhe Xie, Xuezhe Ma, Zihang Dai, Eduard H. Hovy:
An Interpretable Knowledge Transfer Model for Knowledge Base Completion. CoRR abs/1704.05908 (2017)
[i37]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/DasigiADH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/DasigiADH17
Pradeep Dasigi, Waleed Ammar, Chris Dyer, Eduard H. Hovy:
Ontology-Aware Token Embeddings for Prepositional Phrase Attachment. CoRR abs/1705.02925 (2017)
[i36]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/MaYLNH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/MaYLNH17
Xuezhe Ma, Pengcheng Yin, Jingzhou Liu, Graham Neubig, Eduard H. Hovy:
Softmax Q-Distribution Estimation for Structured Prediction: A Theoretical Interpretation for RAML. CoRR abs/1705.07136 (2017)
[i35]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/XieDDHN17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/XieDDHN17
Qizhe Xie, Zihang Dai, Yulun Du, Eduard H. Hovy, Graham Neubig:
Controllable Invariance through Adversarial Feature Learning. CoRR abs/1705.11122 (2017)
[i34]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/JhamtaniGHN17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/JhamtaniGHN17
Harsh Jhamtani, Varun Gangal, Eduard H. Hovy, Eric Nyberg:
Shakespearizing Modern Language Using Copy-Enriched Sequence-to-Sequence Models. CoRR abs/1707.01161 (2017)
[i33]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/GangalJNHN17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/GangalJNHN17
Varun Gangal, Harsh Jhamtani, Graham Neubig, Eduard H. Hovy, Eric Nyberg:
CharManteau: Character Embedding Models For Portmanteau Creation. CoRR abs/1707.01176 (2017)
[i32]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/KangGLCH17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/KangGLCH17
Dongyeop Kang, Varun Gangal, Ang Lu, Zheng Chen, Eduard H. Hovy:
Detecting and Explaining Causes From Text For a Time Series Event. CoRR abs/1707.08852 (2017)
[i31]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1711-03225
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1711-03225
Qizhe Xie, Guokun Lai, Zihang Dai, Eduard H. Hovy:
Large-scale Cloze Test Dataset Designed by Teachers. CoRR abs/1711.03225 (2017)
[i30]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-1711-08792
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1711-08792
Anant Subramanian, Danish Pruthi, Harsh Jhamtani, Taylor Berg-Kirkpatrick, Eduard H. Hovy:
SPINE: SParse Interpretable Neural Embeddings. CoRR abs/1711.08792 (2017)
2016
[i29]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/tac/LiuAMH16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tac/LiuAMH16
Zhengzhong Liu, Jun Araki, Teruko Mitamura, Eduard H. Hovy:
CMU-LTI at KBP 2016 Event Nugget Track. TAC 2016
[i28]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/tac/MaFLH16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tac/MaFLH16
Xuezhe Ma, Nicolas R. Fauceglia, Yiu-Chang Lin, Eduard H. Hovy:
CMU System for Entity Discovery and Linking at TAC-KBP 2016. TAC 2016
[i27]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/tac/MitamuraLH16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tac/MitamuraLH16
Teruko Mitamura, Zhengzhong Liu, Eduard H. Hovy:
Overview of TAC-KBP 2016 Event Nugget Track. TAC 2016
[i26]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/JauharTH16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/JauharTH16
Sujay Kumar Jauhar, Peter D. Turney, Eduard H. Hovy:
TabMCQ: A Dataset of General Knowledge Tables and Multiple-choice Questions. CoRR abs/1602.03960 (2016)
[i25]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/MaH16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/MaH16
Xuezhe Ma, Eduard H. Hovy:
End-to-end Sequence Labeling via Bi-directional LSTM-CNNs-CRF. CoRR abs/1603.01354 (2016)
[i24]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/MaLH16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/MaLH16
Xuezhe Ma, Zhengzhong Liu, Eduard H. Hovy:
Unsupervised Ranking Model for Entity Coreference Resolution. CoRR abs/1603.04553 (2016)
[i23]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/HuMLHX16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/HuMLHX16
Zhiting Hu, Xuezhe Ma, Zhengzhong Liu, Eduard H. Hovy, Eric P. Xing:
Harnessing Deep Neural Networks with Logic Rules. CoRR abs/1603.06318 (2016)
[i22]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/MaGHYDH16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/MaGHYDH16
Xuezhe Ma, Yingkai Gao, Zhiting Hu, Yaoliang Yu, Yuntian Deng, Eduard H. Hovy:
Dropout with Expectation-linear Regularization. CoRR abs/1609.08017 (2016)
[i21]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/CirikHM16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/CirikHM16
Volkan Cirik, Eduard H. Hovy, Louis-Philippe Morency:
Visualizing and Understanding Curriculum Learning for Long Short-Term Memory Networks. CoRR abs/1611.06204 (2016)
2015
[i20]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/tac/FaucegliaLMH15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tac/FaucegliaLMH15
Nicolas R. Fauceglia, Yiu-Chang Lin, Xuezhe Ma, Eduard H. Hovy:
CMU System for Entity Discovery and Linking at TAC-KBP 2015. TAC 2015
[i19]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/tac/LiuADMH15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tac/LiuADMH15
Zhengzhong Liu, Jun Araki, Dheeru Dua, Teruko Mitamura, Eduard H. Hovy:
CMU-LTI at KBP 2015 Event Track. TAC 2015
[i18]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/tac/MitamuraLH15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tac/MitamuraLH15
Teruko Mitamura, Zhengzhong Liu, Eduard H. Hovy:
Overview of TAC KBP 2015 Event Nugget Track. TAC 2015
[i17]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/LiH15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/LiH15
Jiwei Li, Eduard H. Hovy:
The NLP Engine: A Universal Turing Machine for NLP. CoRR abs/1503.00168 (2015)
[i16]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/LiJH15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/LiJH15
Jiwei Li, Dan Jurafsky, Eduard H. Hovy:
When Are Tree Structures Necessary for Deep Learning of Representations? CoRR abs/1503.00185 (2015)
[i15]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/LiCHJ15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/LiCHJ15
Jiwei Li, Xinlei Chen, Eduard H. Hovy, Dan Jurafsky:
Visualizing and Understanding Neural Models in NLP. CoRR abs/1506.01066 (2015)
[i14]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/LiH15b
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/LiH15b
Jiwei Li, Eduard H. Hovy:
Reflections on Sentiment/Opinion Analysis. CoRR abs/1507.01636 (2015)
[i13]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/dagstuhl-reports/GurevychHSS15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/dagstuhl-reports/GurevychHSS15
Iryna Gurevych, Eduard H. Hovy, Noam Slonim, Benno Stein:
Debating Technologies (Dagstuhl Seminar 15512). Dagstuhl Reports 5(12): 18-46 (2015)
2014
[i12]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/LiWH14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/LiWH14
Jiwei Li, Xun Wang, Eduard H. Hovy:
What a Nasty day: Exploring Mood-Weather Relationship from Twitter. CoRR abs/1410.8749 (2014)
[i11]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/FaruquiDJDHS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/FaruquiDJDHS14
Manaal Faruqui, Jesse Dodge, Sujay Kumar Jauhar, Chris Dyer, Eduard H. Hovy, Noah A. Smith:
Retrofitting Word Vectors to Semantic Lexicons. CoRR abs/1411.4166 (2014)
2012
[i10]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/dagstuhl-reports/BuitelaarCCH12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/dagstuhl-reports/BuitelaarCCH12
Paul Buitelaar, Key-Sun Choi, Philipp Cimiano, Eduard H. Hovy:
The Multilingual Semantic Web (Dagstuhl Seminar 12362). Dagstuhl Reports 2(9): 15-94 (2012)
2011
[i9]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/tac/TanZWH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tac/TanZWH11
Yongmei Tan, Junyu Zeng, Xiaojie Wang, Eduard H. Hovy:
BUPTTeam Participation at TAC 2011 Recognizing Textual Entailment. TAC 2011
[i8]
- view
  - electronic edition via DOI (open access)
  - references & citations
  authority control:
- export record
  dblp key:
  - journals/dagstuhl-reports/ClarkWHH11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/dagstuhl-reports/ClarkWHH11
Tim Clark, Anita de Waard, Ivan Herman, Eduard H. Hovy:
The Future of Research Communication (Dagstuhl Perspectives Workshop 11331). Dagstuhl Reports 1(8): 29-52 (2011)
2009
[i7]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/tac/TratzH09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tac/TratzH09
Stephen Tratz, Eduard H. Hovy:
BEwT-E for TAC 2009's AESOP Task. TAC 2009
2008
[i6]
- view
  - electronic edition @ nist.gov (open access)
  - no references & citations available
- export record
  dblp key:
  - conf/tac/TratzH08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/tac/TratzH08
Stephen Tratz, Eduard H. Hovy:
Summarization Evaluation Using Transformed Basic Elements. TAC 2008
2005
[i5]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-cs-0501078
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-cs-0501078
Liang Zhou, Miruna Ticrea, Eduard H. Hovy:
Multi-document Biography Summarization. CoRR abs/cs/0501078 (2005)
2001
[i4]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/cs-CL-0109031
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/cs-CL-0109031
Eneko Agirre, Olatz Ansa, Eduard H. Hovy, David Martínez:
Enriching WordNet concepts with topic signatures. CoRR cs.CL/0109031 (2001)
2000
[i3]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/cs-CL-0010026
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/cs-CL-0010026
Eneko Agirre, Olatz Ansa, Eduard H. Hovy, David Martínez:
Enriching very large ontologies using the WWW. CoRR cs.CL/0010026 (2000)
1995
[i2]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/abs-cmp-lg-9506009
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-cmp-lg-9506009
Kevin Knight, Ishwar Chander, Matthew Haines, Vasileios Hatzivassiloglou, Eduard H. Hovy, Masayo Iida, Steve K. Luk, Richard Whitney, Kenji Yamada:
Filling Knowledge Gaps in a Broad-Coverage Machine Translation System. CoRR abs/cmp-lg/9506009 (1995)
1994
[i1]
- view
  - electronic edition @ arxiv.org (open access)
  - references & citations
- export record
  dblp key:
  - journals/corr/KnightCHHHILOWY94
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/KnightCHHHILOWY94
Kevin Knight, Ishwar Chander, Matthew Haines, Vasileios Hatzivassiloglou, Eduard H. Hovy, Masayo Iida, Steve K. Luk, Akitoshi Okumura, Richard Whitney, Kenji Yamada:
Integrating Knowledge Bases and Statistics in MT. CoRR abs/cmp-lg/9409001 (1994)

Coauthor Index

see FAQ

a service of

manage site settings

To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.