Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDBibTeX records: Ronald Rosenfeld
@inproceedings{DBLP:conf/aaai/0001TGNRW24,
author = {Ananya Joshi and
Tina Townes and
Nolan Gormley and
Luke Neureiter and
Roni Rosenfeld and
Bryan Wilder},
editor = {Michael J. Wooldridge and
Jennifer G. Dy and
Sriraam Natarajan},
title = {Outlier Ranking for Large-Scale Public Health Data},
booktitle = {Thirty-Eighth {AAAI} Conference on Artificial Intelligence, {AAAI}
2024, Thirty-Sixth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2024, Fourteenth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2014, February 20-27, 2024, Vancouver,
Canada},
pages = {22176--22184},
publisher = {{AAAI} Press},
year = {2024},
url = {https://doi.org/10.1609/aaai.v38i20.30222},
doi = {10.1609/AAAI.V38I20.30222},
timestamp = {Tue, 02 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/0001TGNRW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2401-01459,
author = {Ananya Joshi and
Tina Townes and
Nolan Gormley and
Luke Neureiter and
Roni Rosenfeld and
Bryan Wilder},
title = {Outlier Ranking in Large-Scale Public Health Streams},
journal = {CoRR},
volume = {abs/2401.01459},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2401.01459},
doi = {10.48550/ARXIV.2401.01459},
eprinttype = {arXiv},
eprint = {2401.01459},
timestamp = {Mon, 15 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2401-01459.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/0001iMRW23,
author = {Ananya Joshi and
Kathryn Mazaitis and
Roni Rosenfeld and
Bryan Wilder},
title = {Computationally Assisted Quality Control for Public Health Data Streams},
booktitle = {Proceedings of the Thirty-Second International Joint Conference on
Artificial Intelligence, {IJCAI} 2023, 19th-25th August 2023, Macao,
SAR, China},
pages = {6004--6012},
publisher = {ijcai.org},
year = {2023},
url = {https://doi.org/10.24963/ijcai.2023/666},
doi = {10.24963/IJCAI.2023/666},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ijcai/0001iMRW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-16914,
author = {Ananya Joshi and
Kathryn Mazaitis and
Roni Rosenfeld and
Bryan Wilder},
title = {Computationally Assisted Quality Control for Public Health Data Streams},
journal = {CoRR},
volume = {abs/2306.16914},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.16914},
doi = {10.48550/ARXIV.2306.16914},
eprinttype = {arXiv},
eprint = {2306.16914},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-16914.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-02616,
author = {Ruiqi Lyu and
Bryan Wilder and
Roni Rosenfeld},
title = {Federated Epidemic Surveillance},
journal = {CoRR},
volume = {abs/2307.02616},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2307.02616},
doi = {10.48550/ARXIV.2307.02616},
eprinttype = {arXiv},
eprint = {2307.02616},
timestamp = {Mon, 10 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2307-02616.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2309-16546,
author = {Aaron Rumack and
Roni Rosenfeld and
F. William Townes},
title = {Correcting for heterogeneity in real-time epidemiological indicators},
journal = {CoRR},
volume = {abs/2309.16546},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2309.16546},
doi = {10.48550/ARXIV.2309.16546},
eprinttype = {arXiv},
eprint = {2309.16546},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2309-16546.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-13724,
author = {Marc Lipsitch and
Mary T. Bassett and
John S. Brownstein and
Paul Elliott and
David Eyre and
M. Kate Grabowski and
James A. Hay and
Michael A. Johansson and
Stephen M. Kissler and
Daniel B. Larremore and
Jennifer Layden and
Justin Lessler and
Ruth Lynfield and
Duncan MacCannell and
Lawrence C. Madoff and
C. Jessica E. Metcalf and
Lauren Ancel Meyers and
Sylvia K. Ofori and
Celia Quinn and
Ana I. Ramos Bento and
Nick Reich and
Steven Riley and
Roni Rosenfeld and
Matthew H. Samore and
Rangarajan Sampath and
Rachel B. Slayton and
David L. Swerdlow and
Shaun Truelove and
Jay K. Varma and
Yonatan H. Grad},
title = {Infectious disease surveillance needs for the United States: lessons
from {COVID-19}},
journal = {CoRR},
volume = {abs/2311.13724},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.13724},
doi = {10.48550/ARXIV.2311.13724},
eprinttype = {arXiv},
eprint = {2311.13724},
timestamp = {Thu, 30 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-13724.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/RumackTR22,
author = {Aaron Rumack and
Ryan J. Tibshirani and
Roni Rosenfeld},
title = {Recalibrating probabilistic forecasts of epidemics},
journal = {PLoS Comput. Biol.},
volume = {18},
number = {12},
pages = {1010771},
year = {2022},
url = {https://doi.org/10.1371/journal.pcbi.1010771},
doi = {10.1371/JOURNAL.PCBI.1010771},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/RumackTR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pnas/RosenfeldT21,
author = {Roni Rosenfeld and
Ryan J. Tibshirani},
title = {Epidemic tracking and forecasting: Lessons learned from a tumultuous
year},
journal = {Proc. Natl. Acad. Sci. {USA}},
volume = {118},
number = {51},
pages = {e2111456118},
year = {2021},
url = {https://doi.org/10.1073/pnas.2111456118},
doi = {10.1073/PNAS.2111456118},
timestamp = {Fri, 13 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pnas/RosenfeldT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-06305,
author = {Aaron Rumack and
Ryan J. Tibshirani and
Roni Rosenfeld},
title = {Recalibrating probabilistic forecasts of epidemics},
journal = {CoRR},
volume = {abs/2112.06305},
year = {2021},
url = {https://arxiv.org/abs/2112.06305},
eprinttype = {arXiv},
eprint = {2112.06305},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-06305.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/FederVRHHM20,
author = {Amir Feder and
Danny Vainstein and
Roni Rosenfeld and
Tzvika Hartman and
Avinatan Hassidim and
Yossi Matias},
title = {Active deep learning to detect demographic traits in free-form clinical
notes},
journal = {J. Biomed. Informatics},
volume = {107},
pages = {103436},
year = {2020},
url = {https://doi.org/10.1016/j.jbi.2020.103436},
doi = {10.1016/J.JBI.2020.103436},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jbi/FederVRHHM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/ReichMYTROKBCGM19,
author = {Nicholas G. Reich and
Craig J. McGowan and
Teresa K. Yamana and
Abhinav Tushar and
Evan L. Ray and
Dave Osthus and
Sasikiran Kandula and
Logan C. Brooks and
Willow Crawford{-}Crudell and
Graham Casey Gibson and
Evan Moore and
Rebecca Silva and
Matthew Biggerstaff and
Michael A. Johansson and
Roni Rosenfeld and
Jeffrey Shaman},
title = {Accuracy of real-time multi-model ensemble forecasts for seasonal
influenza in the {U.S}},
journal = {PLoS Comput. Biol.},
volume = {15},
number = {11},
year = {2019},
url = {https://doi.org/10.1371/journal.pcbi.1007486},
doi = {10.1371/JOURNAL.PCBI.1007486},
timestamp = {Sat, 25 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ploscb/ReichMYTROKBCGM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/RazaTRSASR19,
author = {Agha Ali Raza and
Zain Tariq and
Shan Randhawa and
Bilal Saleem and
Awais Athar and
Umar Saif and
Roni Rosenfeld},
editor = {Stephen A. Brewster and
Geraldine Fitzpatrick and
Anna L. Cox and
Vassilis Kostakos},
title = {Voice-Based Quizzes for Measuring Knowledge Retention in Under-Connected
Populations},
booktitle = {Proceedings of the 2019 {CHI} Conference on Human Factors in Computing
Systems, {CHI} 2019, Glasgow, Scotland, UK, May 04-09, 2019},
pages = {412},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3290605.3300642},
doi = {10.1145/3290605.3300642},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/RazaTRSASR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/JahjaFRT19,
author = {Maria Jahja and
David C. Farrow and
Roni Rosenfeld and
Ryan J. Tibshirani},
editor = {Hanna M. Wallach and
Hugo Larochelle and
Alina Beygelzimer and
Florence d'Alch{\'{e}}{-}Buc and
Emily B. Fox and
Roman Garnett},
title = {Kalman Filter, Sensor Fusion, and Constrained Regression: Equivalences
and Insights},
booktitle = {Advances in Neural Information Processing Systems 32: Annual Conference
on Neural Information Processing Systems 2019, NeurIPS 2019, December
8-14, 2019, Vancouver, BC, Canada},
pages = {13166--13175},
year = {2019},
url = {https://proceedings.neurips.cc/paper/2019/hash/b522259710151f8cc7870b970b4e0930-Abstract.html},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/JahjaFRT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/BrooksFHTR18,
author = {Logan C. Brooks and
David C. Farrow and
Sangwon Hyun and
Ryan J. Tibshirani and
Roni Rosenfeld},
title = {Nonmechanistic forecasts of seasonal influenza with iterative one-week-ahead
distributions},
journal = {PLoS Comput. Biol.},
volume = {14},
number = {6},
year = {2018},
url = {https://doi.org/10.1371/journal.pcbi.1006134},
doi = {10.1371/JOURNAL.PCBI.1006134},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/BrooksFHTR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/RazaSRTASR18,
author = {Agha Ali Raza and
Bilal Saleem and
Shan Randhawa and
Zain Tariq and
Awais Athar and
Umar Saif and
Roni Rosenfeld},
editor = {Regan L. Mandryk and
Mark Hancock and
Mark Perry and
Anna L. Cox},
title = {Baang: {A} Viral Speech-based Social Platform for Under-Connected
Populations},
booktitle = {Proceedings of the 2018 {CHI} Conference on Human Factors in Computing
Systems, {CHI} 2018, Montreal, QC, Canada, April 21-26, 2018},
pages = {643},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3173574.3174217},
doi = {10.1145/3173574.3174217},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/RazaSRTASR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/RazaARTSZSR18,
author = {Agha Ali Raza and
Awais Athar and
Shan Randhawa and
Zain Tariq and
Muhammad Bilal Saleem and
Haris Bin Zia and
Umar Saif and
Roni Rosenfeld},
editor = {B. Yegnanarayana},
title = {Rapid Collection of Spontaneous Speech Corpora Using Telephonic Community
Forums},
booktitle = {Interspeech 2018, 19th Annual Conference of the International Speech
Communication Association, Hyderabad, India, 2-6 September 2018},
pages = {1021--1025},
publisher = {{ISCA}},
year = {2018},
url = {https://doi.org/10.21437/Interspeech.2018-1139},
doi = {10.21437/INTERSPEECH.2018-1139},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/RazaARTSZSR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/FarrowBHTBR17,
author = {David C. Farrow and
Logan C. Brooks and
Sangwon Hyun and
Ryan J. Tibshirani and
Donald S. Burke and
Roni Rosenfeld},
title = {A human judgment approach to epidemiological forecasting},
journal = {PLoS Comput. Biol.},
volume = {13},
number = {3},
year = {2017},
url = {https://doi.org/10.1371/journal.pcbi.1005248},
doi = {10.1371/JOURNAL.PCBI.1005248},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/FarrowBHTBR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictd/RazaKGBCRR16,
author = {Agha Ali Raza and
Rajat Kulshreshtha and
Spandana Gella and
Sean Blagsvedt and
Maya Chandrasekaran and
Bhiksha Raj and
Roni Rosenfeld},
editor = {Kentaro Toyama},
title = {Viral Spread via Entertainment and Voice-Messaging Among Telephone
Users in India},
booktitle = {Proceedings of the Eighth International Conference on Information
and Communication Technologies and Development, {ICTD} 2016, Ann Arbor,
MI, USA, June 03 - 06, 2016},
pages = {1},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2909609.2909669},
doi = {10.1145/2909609.2909669},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ictd/RazaKGBCRR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/BrooksFHTR15,
author = {Logan C. Brooks and
David C. Farrow and
Sangwon Hyun and
Ryan J. Tibshirani and
Roni Rosenfeld},
title = {Flexible Modeling of Epidemics with an Empirical Bayes Framework},
journal = {PLoS Comput. Biol.},
volume = {11},
number = {8},
year = {2015},
url = {https://doi.org/10.1371/journal.pcbi.1004382},
doi = {10.1371/JOURNAL.PCBI.1004382},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/BrooksFHTR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/slte/WolfeHRRR15,
author = {Nikolas Wolfe and
Juneki Hong and
Agha Ali Raza and
Bhiksha Raj and
Roni Rosenfeld},
editor = {Stefan Steidl and
Anton Batliner and
Oliver Jokisch},
title = {Rapid development of public health education systems in low-literacy
multilingual environments: combating ebola through voice messaging},
booktitle = {{ISCA} International Workshop on Speech and Language Technology in
Education, SLaTE 2015, Leipzig, Germany, September 4-5, 2015},
pages = {131--136},
publisher = {{ISCA}},
year = {2015},
url = {http://www.isca-speech.org/archive/slate\_2015/sl15\_131.html},
timestamp = {Tue, 16 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/slte/WolfeHRRR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pakdd/LinRLKRF14,
author = {Yibin Lin and
Agha Ali Raza and
Jay Yoon Lee and
Danai Koutra and
Roni Rosenfeld and
Christos Faloutsos},
editor = {Vincent S. Tseng and
Tu Bao Ho and
Zhi{-}Hua Zhou and
Arbee L. P. Chen and
Hung{-}Yu Kao},
title = {Influence Propagation: Patterns, Model and a Case Study},
booktitle = {Advances in Knowledge Discovery and Data Mining - 18th Pacific-Asia
Conference, {PAKDD} 2014, Tainan, Taiwan, May 13-16, 2014. Proceedings,
Part {I}},
series = {Lecture Notes in Computer Science},
volume = {8443},
pages = {386--397},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-06608-0\_32},
doi = {10.1007/978-3-319-06608-0\_32},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pakdd/LinRLKRF14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/RazaHTPRSR13,
author = {Agha Ali Raza and
Farhan ul Haq and
Zain Tariq and
Mansoor Pervaiz and
Samia Razaq and
Umar Saif and
Roni Rosenfeld},
editor = {Wendy E. Mackay and
Stephen A. Brewster and
Susanne B{\o}dker},
title = {Job opportunities through entertainment: virally spread speech-based
services for low-literate users},
booktitle = {2013 {ACM} {SIGCHI} Conference on Human Factors in Computing Systems,
{CHI} '13, Paris, France, April 27 - May 2, 2013},
pages = {2803--2812},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2470654.2481389},
doi = {10.1145/2470654.2481389},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/RazaHTPRSR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dev/WangRLR13,
author = {Haohan Wang and
Agha Ali Raza and
Yibin Lin and
Roni Rosenfeld},
editor = {William D. Tucker and
Antoine B. Bagula and
Margaret Martonosi and
Bhaskaran Raman},
title = {Behavior analysis of low-literate users of a viral speech-based telephone
service},
booktitle = {Annual Symposium on Computing for Development, {ACM} DEV-4, Cape Town,
South Africa - December 06 - 07, 2013},
pages = {12:1--12:9},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2537052.2537062},
doi = {10.1145/2537052.2537062},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dev/WangRLR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dev/RazaRHTS13,
author = {Agha Ali Raza and
Roni Rosenfeld and
Farhan ul Haq and
Zain Tariq and
Umar Saif},
editor = {Bill Thies and
Amit Nanavati},
title = {Spread and sustainability: the geography and economics of speech-based
services},
booktitle = {Annual Symposium on Computing for Development, {ACM} {DEV} '13, Bangalore,
India - January 11 - 12, 2013},
pages = {39:1--39:2},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2442882.2442927},
doi = {10.1145/2442882.2442927},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dev/RazaRHTS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/SchulamRD13,
author = {Peter Schulam and
Roni Rosenfeld and
Premkumar T. Devanbu},
title = {Building Statistical Language Models of code},
booktitle = {1st International Workshop on Data Analysis Patterns in Software Engineering,
DAPSE@ICSE 2013, San Francisco, CA, USA, May 21, 2013},
pages = {1--3},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/DAPSE.2013.6603797},
doi = {10.1109/DAPSE.2013.6603797},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icse/SchulamRD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dev/ChanR12,
author = {Hao Yee Chan and
Roni Rosenfeld},
editor = {Ed Cutrell and
Ellen W. Zegura and
Gaetano Borriello and
Bill Thies},
title = {Discriminative pronunciation learning for speech recognition for resource
scarce languages},
booktitle = {{ACM} Annual Symposium on Computing for Development, {ACM} {DEV} '12,
Atlanta, GA, {USA} - March 10 - 11, 2012},
pages = {12:1--12:6},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2160601.2160618},
doi = {10.1145/2160601.2160618},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dev/ChanR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictd/RazaPMRASSR12,
author = {Agha Ali Raza and
Mansoor Pervaiz and
Christina Milo and
Samia Razaq and
Guy Alster and
Jahanzeb Sherwani and
Umar Saif and
Roni Rosenfeld},
editor = {Michael L. Best and
Ellen W. Zegura and
Jonathan Donner and
Beki Grinter and
Gary Marsden},
title = {Viral entertainment as a vehicle for disseminating speech-based services
to low-literate users},
booktitle = {Fifth International Conference on Information and Communication Technologies
and Development, {ICTD} '12, Atlanta, GA, USA, March 12-15, 2012},
pages = {350--359},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2160673.2160715},
doi = {10.1145/2160673.2160715},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ictd/RazaPMRASSR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kdd/BeutelPRF12,
author = {Alex Beutel and
B. Aditya Prakash and
Roni Rosenfeld and
Christos Faloutsos},
editor = {Qiang Yang and
Deepak Agarwal and
Jian Pei},
title = {Interacting viruses in networks: can both survive?},
booktitle = {The 18th {ACM} {SIGKDD} International Conference on Knowledge Discovery
and Data Mining, {KDD} '12, Beijing, China, August 12-16, 2012},
pages = {426--434},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2339530.2339601},
doi = {10.1145/2339530.2339601},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/kdd/BeutelPRF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/PrakashBRF12,
author = {B. Aditya Prakash and
Alex Beutel and
Roni Rosenfeld and
Christos Faloutsos},
editor = {Alain Mille and
Fabien Gandon and
Jacques Misselis and
Michael Rabinovich and
Steffen Staab},
title = {Winner takes all: competing viruses or ideas on fair-play networks},
booktitle = {Proceedings of the 21st World Wide Web Conference 2012, {WWW} 2012,
Lyon, France, April 16-20, 2012},
pages = {1037--1046},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2187836.2187975},
doi = {10.1145/2187836.2187975},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/www/PrakashBRF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/psb/WuWR11,
author = {Chuang Wu and
Andrew S. Walsh and
Roni Rosenfeld},
editor = {Russ B. Altman and
A. Keith Dunker and
Lawrence Hunter and
Tiffany Murray and
Teri E. Klein},
title = {Genotype Phenotype Mapping in Rna Viruses - Disjunctive Normal Form
Learning},
booktitle = {Biocomputing 2011: Proceedings of the Pacific Symposium, Kohala Coast,
Hawaii, USA, 3-7 January 2011},
pages = {62--73},
publisher = {World Scientific Publishing},
year = {2011},
url = {http://psb.stanford.edu/psb-online/proceedings/psb11/wu.pdf},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/psb/WuWR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcb/LuRNB10,
author = {Yong Lu and
Roni Rosenfeld and
Gerard J. Nau and
Ziv Bar{-}Joseph},
title = {Cross Species Expression Analysis of Innate Immune Response},
journal = {J. Comput. Biol.},
volume = {17},
number = {3},
pages = {253--268},
year = {2010},
url = {https://doi.org/10.1089/cmb.2009.0147},
doi = {10.1089/CMB.2009.0147},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcb/LuRNB10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibe/WuWR10,
author = {Chuang Wu and
Andrew S. Walsh and
Roni Rosenfeld},
title = {Identification of Viral Protein Genotypic Determinants Using Combinatorial
Filtering and Active Learning},
booktitle = {10th {IEEE} International Conference on Bioinformatics and Bioengineering,
{BIBE} 2010, Philadelphia, Pennsylvania, USA, May 31-June 3 2010},
pages = {162--167},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/BIBE.2010.25},
doi = {10.1109/BIBE.2010.25},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bibe/WuWR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dev/QiaoSR10,
author = {Fang Qiao and
Jahanzeb Sherwani and
Roni Rosenfeld},
editor = {Andrew M. Dearden and
Tapan S. Parikh and
Lakshminarayanan Subramanian},
title = {Small-vocabulary speech recognition for resource-scarce languages},
booktitle = {First {ACM} Annual Symposium on Computing for Development, {ACM} {DEV}
'10, London, United Kingdom, December 17 - 18, 2010},
pages = {3},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1926180.1926184},
doi = {10.1145/1926180.1926184},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dev/QiaoSR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictd/SherwaniPMAAR09,
author = {Jahanzeb Sherwani and
Sooraj Palijo and
Sarwat Mirza and
Tanveer Ahmed and
Nosheen Ali and
Roni Rosenfeld},
editor = {M. Bernardine Dias and
Richard Heeks and
Rahul Tongia},
title = {Speech vs. touch-tone: Telephony interfaces for information access
by low literate users},
booktitle = {2009 International Conference on Information and Communication Technologies
and Development, {ICTD} 2009, Education City, Doha, Qatar, April 17-19,
2009},
pages = {447--457},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/ICTD.2009.5426682},
doi = {10.1109/ICTD.2009.5426682},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ictd/SherwaniPMAAR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/recomb/LuRNB09,
author = {Yong Lu and
Roni Rosenfeld and
Gerard J. Nau and
Ziv Bar{-}Joseph},
editor = {Serafim Batzoglou},
title = {Cross Species Expression Analysis of Innate Immune Response},
booktitle = {Research in Computational Molecular Biology, 13th Annual International
Conference, {RECOMB} 2009, Tucson, AZ, USA, May 18-21, 2009. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5541},
pages = {90--107},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-02008-7\_7},
doi = {10.1007/978-3-642-02008-7\_7},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/recomb/LuRNB09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/slt/WeberBRT08,
author = {Frederick Weber and
Kalika Bali and
Roni Rosenfeld and
Kentaro Toyama},
editor = {Amitava Das and
Srinivas Bangalore},
title = {Unexplored directions in spoken language technology for development},
booktitle = {2008 {IEEE} Spoken Language Technology Workshop, {SLT} 2008, Goa,
India, December 15-19, 2008},
pages = {1--4},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/SLT.2008.4777825},
doi = {10.1109/SLT.2008.4777825},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/slt/WeberBRT08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictd/SherwaniAMFMKTR07,
author = {Jahanzeb Sherwani and
Nosheen Ali and
Sarwat Mirza and
Anjum Fatma and
Yousuf Memon and
Mehtab Karim and
Rahul Tongia and
Roni Rosenfeld},
title = {HealthLine: Speech-based access to health information by low-literate
users},
booktitle = {2007 International Conference on Information and Communication Technologies
and Development, {ICTD} 2007, Bangalore, India, December 15-16, 2007},
pages = {1--9},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/ICTD.2007.4937399},
doi = {10.1109/ICTD.2007.4937399},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ictd/SherwaniAMFMKTR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/TomkoR06,
author = {Stefanie Tomko and
Roni Rosenfeld},
editor = {Gary M. Olson and
Robin Jeffries},
title = {Shaping user input in speech graffiti: a first pass},
booktitle = {Extended Abstracts Proceedings of the 2006 Conference on Human Factors
in Computing Systems, {CHI} 2006, Montr{\'{e}}al, Qu{\'{e}}bec,
Canada, April 22-27, 2006},
pages = {1439--1444},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1125451.1125716},
doi = {10.1145/1125451.1125716},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/TomkoR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/SherwaniTR06,
author = {Jahanzeb Sherwani and
Stefanie Tomko and
Roni Rosenfeld},
title = {Sublime: {A} Speech- and Language-Based Information Management Environment},
booktitle = {2006 {IEEE} International Conference on Acoustics Speech and Signal
Processing, {ICASSP} 2006, Toulouse, France, May 14-19, 2006},
pages = {629--632},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/ICASSP.2006.1660099},
doi = {10.1109/ICASSP.2006.1660099},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/SherwaniTR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ismb/LuRB06,
author = {Yong Lu and
Ronald Rosenfeld and
Ziv Bar{-}Joseph},
title = {Identifying cycling genes by combining sequence homology and expression
data},
booktitle = {Proceedings 14th International Conference on Intelligent Systems for
Molecular Biology 2006, Fortaleza, Brazil, August 6-10, 2006},
pages = {314--322},
year = {2006},
url = {https://doi.org/10.1093/bioinformatics/btl229},
doi = {10.1093/BIOINFORMATICS/BTL229},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ismb/LuRB06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/slt/TomkoR06,
author = {Stefanie Tomko and
Roni Rosenfeld},
editor = {Mazin Gilbert and
Hermann Ney},
title = {Shaping to convergence: Experiments with speech Graffiti},
booktitle = {2006 {IEEE} {ACL} Spoken Language Technology Workshop, {SLT} 2006,
Palm Beach, Aruba, December 10-13, 2006},
pages = {150--153},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/SLT.2006.326840},
doi = {10.1109/SLT.2006.326840},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/slt/TomkoR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcb/LeungCYRT05,
author = {Henry C. M. Leung and
Francis Y. L. Chin and
Siu{-}Ming Yiu and
Ronald Rosenfeld and
Wai Wan Tsang},
title = {Finding Motifs with Insufficient Number of Strong Binding Sites},
journal = {J. Comput. Biol.},
volume = {12},
number = {6},
pages = {686--701},
year = {2005},
url = {https://doi.org/10.1089/cmb.2005.12.686},
doi = {10.1089/CMB.2005.12.686},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcb/LeungCYRT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tslp/TomkoHTSRR05,
author = {Stefanie Tomko and
Thomas K. Harris and
Arthur R. Toth and
James Sanders and
Alexander I. Rudnicky and
Roni Rosenfeld},
title = {Towards efficient human machine speech communication: The speech graffiti
project},
journal = {{ACM} Trans. Speech Lang. Process.},
volume = {2},
number = {1},
pages = {1--27},
year = {2005},
url = {https://doi.org/10.1145/1075389.1075391},
doi = {10.1145/1075389.1075391},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tslp/TomkoHTSRR05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/HarrisR04,
author = {Thomas K. Harris and
Roni Rosenfeld},
title = {A universal speech interface for appliances},
booktitle = {{INTERSPEECH} 2004 - ICSLP, 8th International Conference on Spoken
Language Processing, Jeju Island, Korea, October 4-8, 2004},
pages = {249--252},
publisher = {{ISCA}},
year = {2004},
url = {https://doi.org/10.21437/Interspeech.2004-130},
doi = {10.21437/INTERSPEECH.2004-130},
timestamp = {Thu, 22 Jun 2023 16:42:17 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/HarrisR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/TomkoR04,
author = {Stefanie Tomko and
Roni Rosenfeld},
title = {Shaping spoken input in user-initiative systems},
booktitle = {{INTERSPEECH} 2004 - ICSLP, 8th International Conference on Spoken
Language Processing, Jeju Island, Korea, October 4-8, 2004},
pages = {2825--2828},
publisher = {{ISCA}},
year = {2004},
url = {https://doi.org/10.21437/Interspeech.2004-728},
doi = {10.21437/INTERSPEECH.2004-728},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/TomkoR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ismb/Bar-JosephFGSR04,
author = {Ziv Bar{-}Joseph and
Shlomit Farkash and
David K. Gifford and
Itamar Simon and
Roni Rosenfeld},
title = {Deconvolving cell cycle expression data with complementary information},
booktitle = {Proceedings Twelfth International Conference on Intelligent Systems
for Molecular Biology/Third European Conference on Computational Biology
2004, Glasgow, UK, July 31-August 4, 2004},
pages = {23--30},
year = {2004},
url = {https://doi.org/10.1093/bioinformatics/bth924},
doi = {10.1093/BIOINFORMATICS/BTH924},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ismb/Bar-JosephFGSR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/TomkoR04,
author = {Stefanie Tomko and
Roni Rosenfeld},
title = {Speech Graffiti vs. Natural Language: Assessing the User Experience},
booktitle = {Proceedings of {HLT-NAACL} 2004: Short Papers, Boston, Massachusetts,
USA, May 2-7, 2004},
publisher = {The Association for Computational Linguistics},
year = {2004},
url = {https://aclanthology.org/N04-4019/},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/TomkoR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/recomb/ChinLYLRTSJ04,
author = {Francis Y. L. Chin and
Henry C. M. Leung and
Siu{-}Ming Yiu and
Tak Wah Lam and
Roni Rosenfeld and
Wai Wan Tsang and
David K. Smith and
Y. Jiang},
editor = {Philip E. Bourne and
Dan Gusfield},
title = {Finding motifs for insufficient number of sequences with strong binding
to transcription facto},
booktitle = {Proceedings of the Eighth Annual International Conference on Computational
Molecular Biology, 2004, San Diego, California, USA, March 27-31,
2004},
pages = {125--132},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/974614.974631},
doi = {10.1145/974614.974631},
timestamp = {Tue, 04 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/recomb/ChinLYLRTSJ04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigdial/TomkoR04,
author = {Stefanie Tomko and
Roni Rosenfeld},
editor = {Michael Strube and
Candy L. Sidner},
title = {Speech Graffiti Habitability: What Do Users Really Say?},
booktitle = {Proceedings of the {SIGDIAL} 2004 Workshop, The 5th Annual Meeting
of the Special Interest Group on Discourse and Dialogue, April 30
- May 1, 2004, Cambridge, Massachusetts, {USA}},
pages = {81--84},
publisher = {The Association for Computer Linguistics},
year = {2004},
url = {https://aclanthology.org/W04-2315/},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigdial/TomkoR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003},
url = {https://doi.org/10.1145/945546.945549},
doi = {10.1145/945546.945549},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/NicholsMHHHRL03,
author = {Jeffrey Nichols and
Brad A. Myers and
Michael Higgins and
Joseph Hughes and
Thomas K. Harris and
Roni Rosenfeld and
Kevin Litwack},
editor = {Gilbert Cockton and
Panu Korhonen},
title = {Personal universal controllers: controlling complex appliances with
GUIs and speech},
booktitle = {Extended abstracts of the 2003 Conference on Human Factors in Computing
Systems, {CHI} 2003, Ft. Lauderdale, Florida, USA, April 5-10, 2003},
pages = {624--625},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/765891.765896},
doi = {10.1145/765891.765896},
timestamp = {Sun, 26 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/chi/NicholsMHHHRL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/ShriverR02,
author = {Stefanie Shriver and
Ronald Rosenfeld},
editor = {Loren G. Terveen and
Dennis R. Wixon},
title = {Keywords for a universal speech interface},
booktitle = {Extended abstracts of the 2002 Conference on Human Factors in Computing
Systems, {CHI} 2002, Minneapolis, Minnesota, USA, April 20-25, 2002},
pages = {726--727},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/506443.506567},
doi = {10.1145/506443.506567},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/ShriverR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmi/NicholsMHRSHH02,
author = {Jeffrey Nichols and
Brad A. Myers and
Thomas K. Harris and
Roni Rosenfeld and
Stefanie Shriver and
Michael Higgins and
Joseph Hughes},
title = {Requirements for Automatically Generating Multi-Modal Interfaces for
Complex Appliances},
booktitle = {4th {IEEE} International Conference on Multimodal Interfaces {(ICMI}
2002), 14-16 October 2002, Pittsburgh, PA, {USA}},
pages = {377--382},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/ICMI.2002.1167024},
doi = {10.1109/ICMI.2002.1167024},
timestamp = {Sun, 26 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmi/NicholsMHRSHH02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/TothHSSR02,
author = {Arthur R. Toth and
Thomas K. Harris and
James Sanders and
Stefanie Shriver and
Roni Rosenfeld},
editor = {John H. L. Hansen and
Bryan L. Pellom},
title = {Towards every-citizen{\({^2}\)}s speech interface: an application
generator for speech interfaces to databases},
booktitle = {7th International Conference on Spoken Language Processing, {ICSLP2002}
- {INTERSPEECH} 2002, Denver, Colorado, USA, September 16-20, 2002},
pages = {1497--1500},
publisher = {{ISCA}},
year = {2002},
url = {https://doi.org/10.21437/ICSLP.2002-451},
doi = {10.21437/ICSLP.2002-451},
timestamp = {Thu, 22 Jun 2023 16:42:18 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/TothHSSR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uist/NicholsMHHHRP02,
author = {Jeffrey Nichols and
Brad A. Myers and
Michael Higgins and
Joseph Hughes and
Thomas K. Harris and
Roni Rosenfeld and
Mathilde Pignol},
editor = {Michel Beaudouin{-}Lafon},
title = {Generating remote control interfaces for complex appliances},
booktitle = {Proceedings of the 15th Annual {ACM} Symposium on User Interface Software
and Technology, Paris, France, October 27-30, 2002},
pages = {161--170},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/571985.572008},
doi = {10.1145/571985.572008},
timestamp = {Sun, 26 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/uist/NicholsMHHHRP02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csl/RosenfeldCZ01,
author = {Ronald Rosenfeld and
Stanley F. Chen and
Xiaojin Zhu},
title = {Whole-sentence exponential language models: a vehicle for linguistic-statistical
integration},
journal = {Comput. Speech Lang.},
volume = {15},
number = {1},
pages = {55--73},
year = {2001},
url = {https://doi.org/10.1006/csla.2000.0159},
doi = {10.1006/CSLA.2000.0159},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csl/RosenfeldCZ01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/interactions/RosenfeldOR01,
author = {Ronald Rosenfeld and
Dan R. Olsen and
Alexander I. Rudnicky},
title = {Universal speech interfaces},
journal = {Interactions},
volume = {8},
number = {6},
pages = {34--44},
year = {2001},
url = {https://doi.org/10.1145/384076.384085},
doi = {10.1145/384076.384085},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/interactions/RosenfeldOR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/ShriverTZRR01,
author = {Stefanie Shriver and
Arthur R. Toth and
Xiaojin Zhu and
Alexander I. Rudnicky and
Roni Rosenfeld},
editor = {Marilyn Mantai Tremaine},
title = {A unified design for human-machine voice interaction},
booktitle = {{CHI} 2001 Extended Abstracts on Human Factors in Computing Systems,
{CHI} Extended Abstracts 2001, Seattle, Washington, USA, March 31
- April 5, 2001},
pages = {247--248},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/634067.634214},
doi = {10.1145/634067.634214},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/ShriverTZRR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/ZhuR01,
author = {Xiaojin Zhu and
Ronald Rosenfeld},
title = {Improving trigram language modeling with the World Wide Web},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
{ICASSP} 2001, 7-11 May, 2001, Salt Palace Convention Center, Salt
Lake City, Utah, USA, Proceedings},
pages = {533--536},
publisher = {{IEEE}},
year = {2001},
url = {https://doi.org/10.1109/ICASSP.2001.940885},
doi = {10.1109/ICASSP.2001.940885},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/ZhuR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/ShriverRZTRF01,
author = {Stefanie Shriver and
Roni Rosenfeld and
Xiaojin Zhu and
Arthur R. Toth and
Alexander I. Rudnicky and
Markus D. Fl{\"{u}}ckiger},
editor = {Paul Dalsgaard and
B{\o}rge Lindberg and
Henrik Benner and
Zheng{-}Hua Tan},
title = {Universalizing speech: notes from the {USI} project},
booktitle = {{EUROSPEECH} 2001 Scandinavia, 7th European Conference on Speech Communication
and Technology, 2nd {INTERSPEECH} Event, Aalborg, Denmark, September
3-7, 2001},
pages = {1563--1566},
publisher = {{ISCA}},
year = {2001},
url = {https://doi.org/10.21437/Eurospeech.2001-351},
doi = {10.21437/EUROSPEECH.2001-351},
timestamp = {Fri, 08 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/interspeech/ShriverRZTRF01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/Rosenfeld00,
author = {Ronald Rosenfeld},
title = {Two decades of statistical language modeling: where do we go from
here?},
journal = {Proc. {IEEE}},
volume = {88},
number = {8},
pages = {1270--1278},
year = {2000},
url = {https://doi.org/10.1109/5.880083},
doi = {10.1109/5.880083},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pieee/Rosenfeld00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/GlassR00,
author = {James R. Glass and
Ronald Rosenfeld},
title = {Guest editorial introduction to the special issue on language modeling
and dialogue systems},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {8},
number = {1},
pages = {1--2},
year = {2000},
url = {https://doi.org/10.1109/TSA.2000.817448},
doi = {10.1109/TSA.2000.817448},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taslp/GlassR00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/ChenR00,
author = {Stanley F. Chen and
Ronald Rosenfeld},
title = {A survey of smoothing techniques for {ME} models},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {8},
number = {1},
pages = {37--50},
year = {2000},
url = {https://doi.org/10.1109/89.817452},
doi = {10.1109/89.817452},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taslp/ChenR00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/RosenfeldZTSLB00,
author = {Roni Rosenfeld and
Xiaojin Zhu and
Arthur R. Toth and
Stefanie Shriver and
Kevin A. Lenzo and
Alan W. Black},
title = {Towards a universal speech interface},
booktitle = {Sixth International Conference on Spoken Language Processing, {ICSLP}
2000 / {INTERSPEECH} 2000, Beijing, China, October 16-20, 2000},
pages = {102--105},
publisher = {{ISCA}},
year = {2000},
url = {https://doi.org/10.21437/ICSLP.2000-219},
doi = {10.21437/ICSLP.2000-219},
timestamp = {Thu, 22 Jun 2023 16:42:19 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/RosenfeldZTSLB00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/ShriverBR00,
author = {Stefanie Shriver and
Alan W. Black and
Ronald Rosenfeld},
title = {Audio signals in speech interfaces},
booktitle = {Sixth International Conference on Spoken Language Processing, {ICSLP}
2000 / {INTERSPEECH} 2000, Beijing, China, October 16-20, 2000},
pages = {142--145},
publisher = {{ISCA}},
year = {2000},
url = {https://doi.org/10.21437/ICSLP.2000-35},
doi = {10.21437/ICSLP.2000-35},
timestamp = {Thu, 22 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/ShriverBR00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/ChenR99,
author = {Stanley F. Chen and
Ronald Rosenfeld},
title = {Efficient sampling and feature selection in whole sentence maximum
entropy language models},
booktitle = {Proceedings of the 1999 {IEEE} International Conference on Acoustics,
Speech, and Signal Processing, {ICASSP} '99, Phoenix, Arizona, USA,
March 15-19, 1999},
pages = {549--552},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/ICASSP.1999.758184},
doi = {10.1109/ICASSP.1999.758184},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/ChenR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/KalaiCBR99,
author = {Adam Kalai and
Stanley F. Chen and
Avrim Blum and
Ronald Rosenfeld},
title = {On-line algorithms for combining language models},
booktitle = {Proceedings of the 1999 {IEEE} International Conference on Acoustics,
Speech, and Signal Processing, {ICASSP} '99, Phoenix, Arizona, USA,
March 15-19, 1999},
pages = {745--748},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/ICASSP.1999.759774},
doi = {10.1109/ICASSP.1999.759774},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/KalaiCBR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/ZhuCR99,
author = {Xiaojin Zhu and
Stanley F. Chen and
Ronald Rosenfeld},
title = {Linguistic features for whole sentence maximum entropy language models},
booktitle = {Sixth European Conference on Speech Communication and Technology,
{EUROSPEECH} 1999, Budapest, Hungary, September 5-9, 1999},
pages = {1807--1810},
publisher = {{ISCA}},
year = {1999},
url = {https://doi.org/10.21437/Eurospeech.1999-363},
doi = {10.21437/EUROSPEECH.1999-363},
timestamp = {Sat, 01 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/ZhuCR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/ChenSR98,
author = {Stanley F. Chen and
Kristie Seymore and
Ronald Rosenfeld},
title = {Topic adaptation for language modeling using unnormalized exponential
models},
booktitle = {Proceedings of the 1998 {IEEE} International Conference on Acoustics,
Speech and Signal Processing, {ICASSP} '98, Seattle, Washington, USA,
May 12-15, 1998},
pages = {681--684},
publisher = {{IEEE}},
year = {1998},
url = {https://doi.org/10.1109/ICASSP.1998.675356},
doi = {10.1109/ICASSP.1998.675356},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/ChenSR98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/McCallumRMN98,
author = {Andrew McCallum and
Ronald Rosenfeld and
Tom M. Mitchell and
Andrew Y. Ng},
editor = {Jude W. Shavlik},
title = {Improving Text Classification by Shrinkage in a Hierarchy of Classes},
booktitle = {Proceedings of the Fifteenth International Conference on Machine Learning
{(ICML} 1998), Madison, Wisconsin, USA, July 24-27, 1998},
pages = {359--367},
publisher = {Morgan Kaufmann},
year = {1998},
timestamp = {Thu, 30 Jun 2011 10:34:12 +0200},
biburl = {https://dblp.org/rec/conf/icml/McCallumRMN98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/SeymoreCR98,
author = {Kristie Seymore and
Stanley F. Chen and
Ronald Rosenfeld},
title = {Nonlinear interpolation of topic models for language model adaptation},
booktitle = {The 5th International Conference on Spoken Language Processing, Incorporating
The 7th Australian International Speech Science and Technology Conference,
Sydney Convention Centre, Sydney, Australia, 30th November - 4th December
1998},
publisher = {{ISCA}},
year = {1998},
url = {https://doi.org/10.21437/ICSLP.1998-667},
doi = {10.21437/ICSLP.1998-667},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/SeymoreCR98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/SeymoreR97,
author = {Kristie Seymore and
Ronald Rosenfeld},
editor = {George Kokkinakis and
Nikos Fakotakis and
Evangelos Dermatas},
title = {Using story topics for language model adaptation},
booktitle = {Fifth European Conference on Speech Communication and Technology,
{EUROSPEECH} 1997, Rhodes, Greece, September 22-25, 1997},
pages = {1987--1990},
publisher = {{ISCA}},
year = {1997},
url = {https://doi.org/10.21437/Eurospeech.1997-527},
doi = {10.21437/EUROSPEECH.1997-527},
timestamp = {Sun, 06 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/SeymoreR97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/ClarksonR97,
author = {Philip Clarkson and
Ronald Rosenfeld},
editor = {George Kokkinakis and
Nikos Fakotakis and
Evangelos Dermatas},
title = {Statistical language modeling using the CMU-cambridge toolkit},
booktitle = {Fifth European Conference on Speech Communication and Technology,
{EUROSPEECH} 1997, Rhodes, Greece, September 22-25, 1997},
pages = {2707--2710},
publisher = {{ISCA}},
year = {1997},
url = {https://doi.org/10.21437/Eurospeech.1997-683},
doi = {10.21437/EUROSPEECH.1997-683},
timestamp = {Sun, 02 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/ClarksonR97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/ChelbaEJJKMPRRSW97,
author = {Ciprian Chelba and
David Engle and
Frederick Jelinek and
Victor Jimenez and
Sanjeev Khudanpur and
Lidia Mangu and
Harry Printz and
Eric Ristad and
Ronald Rosenfeld and
Andreas Stolcke and
Dekai Wu},
editor = {George Kokkinakis and
Nikos Fakotakis and
Evangelos Dermatas},
title = {Structure and performance of a dependency language model},
booktitle = {Fifth European Conference on Speech Communication and Technology,
{EUROSPEECH} 1997, Rhodes, Greece, September 22-25, 1997},
pages = {2775--2778},
publisher = {{ISCA}},
year = {1997},
url = {https://doi.org/10.21437/Eurospeech.1997-700},
doi = {10.21437/EUROSPEECH.1997-700},
timestamp = {Sun, 02 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/ChelbaEJJKMPRRSW97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csl/Rosenfeld96,
author = {Ronald Rosenfeld},
title = {A maximum entropy approach to adaptive statistical language modelling},
journal = {Comput. Speech Lang.},
volume = {10},
number = {3},
pages = {187--228},
year = {1996},
url = {https://doi.org/10.1006/csla.1996.0011},
doi = {10.1006/CSLA.1996.0011},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csl/Rosenfeld96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/SeymoreR96,
author = {Kristie Seymore and
Ronald Rosenfeld},
title = {Scalable backoff language models},
booktitle = {The 4th International Conference on Spoken Language Processing, Philadelphia,
PA, USA, October 3-6, 1996},
pages = {232--235},
publisher = {{ISCA}},
year = {1996},
url = {https://doi.org/10.21437/ICSLP.1996-71},
doi = {10.21437/ICSLP.1996-71},
timestamp = {Thu, 22 Jun 2023 16:42:20 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/SeymoreR96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/Rosenfeld95,
author = {Ronald Rosenfeld},
title = {Optimizing lexical and N-gram coverage via judicious use of linguistic
data},
booktitle = {Fourth European Conference on Speech Communication and Technology,
{EUROSPEECH} 1995, Madrid, Spain, September 18-21, 1995},
pages = {1763--1766},
publisher = {{ISCA}},
year = {1995},
url = {https://doi.org/10.21437/Eurospeech.1995-320},
doi = {10.21437/EUROSPEECH.1995-320},
timestamp = {Sun, 06 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/Rosenfeld95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/HwangRTRCWHA94,
author = {Mei{-}Yuh Hwang and
Ronald Rosenfeld and
Eric H. Thayer and
Mosur Ravishankar and
Lin Lawrence Chase and
Robert Weide and
Xuedong Huang and
Fil Alleva},
title = {Improving speech recognition performance via phone-dependent {VQ}
codebooks and adaptive language models in {SPHINX-II}},
booktitle = {Proceedings of {ICASSP} '94: {IEEE} International Conference on Acoustics,
Speech and Signal Processing, Adelaide, South Australia, Australia,
April 19-22, 1994},
pages = {549--552},
publisher = {{IEEE} Computer Society},
year = {1994},
url = {https://doi.org/10.1109/ICASSP.1994.389235},
doi = {10.1109/ICASSP.1994.389235},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/HwangRTRCWHA94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/ChaseRW94,
author = {Lin Lawrence Chase and
Ronald Rosenfeld and
Wayne H. Ward},
title = {Error-responsive modifications to speech recognizers: negative n-grams},
booktitle = {The 3rd International Conference on Spoken Language Processing, {ICSLP}
1994, Yokohama, Japan, September 18-22, 1994},
pages = {827--830},
publisher = {{ISCA}},
year = {1994},
url = {https://doi.org/10.21437/ICSLP.1994-221},
doi = {10.21437/ICSLP.1994-221},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/ChaseRW94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/KubalaBCPPPRRRRRW94,
author = {Francis Kubala and
Jerome R. Bellegarda and
Jordan Cohen and
David S. Pallett and
Doug Paul and
Mike Phillips and
Raja Rajasekaran and
Fred Richardson and
Michael Riley and
Roni Rosenfeld and
Bob Roth and
Mitch Weintraub},
title = {The Hub and Spoke Paradigm for {CSR} Evaluation},
booktitle = {Human Language Technology, Proceedings of a Workshop held at Plainsboro,
New Jerey, USA, March 8-11, 1994},
publisher = {Morgan Kaufmann},
year = {1994},
url = {https://aclanthology.org/H94-1009/},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/KubalaBCPPPRRRRRW94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/Rosenfeld94,
author = {Ronald Rosenfeld},
title = {A Hybrid Approach to Adaptive Statistical Language Modeling},
booktitle = {Human Language Technology, Proceedings of a Workshop held at Plainsboro,
New Jerey, USA, March 8-11, 1994},
publisher = {Morgan Kaufmann},
year = {1994},
url = {https://aclanthology.org/H94-1013/},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/Rosenfeld94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csl/HuangAHHLR93,
author = {Xuedong Huang and
Fileno A. Alleva and
Hsiao{-}Wuen Hon and
Mei{-}Yuh Hwang and
Kai{-}Fu Lee and
Ronald Rosenfeld},
title = {The {SPHINX-II} speech recognition system: an overview},
journal = {Comput. Speech Lang.},
volume = {7},
number = {2},
pages = {137--148},
year = {1993},
url = {https://doi.org/10.1006/csla.1993.1007},
doi = {10.1006/CSLA.1993.1007},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csl/HuangAHHLR93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/LauRR93,
author = {Raymond Lau and
Ronald Rosenfeld and
Salim Roukos},
title = {Trigger-based language models: a maximum entropy approach},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
{ICASSP} '93, Minneapolis, Minnesota, USA, April 27-30, 1993},
pages = {45--48},
publisher = {{IEEE} Computer Society},
year = {1993},
url = {https://doi.ieeecomputersociety.org/10.1109/ICASSP.1993.319225},
doi = {10.1109/ICASSP.1993.319225},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/LauRR93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/HuangAHR93,
author = {Xuedong Huang and
Fileno A. Alleva and
Mei{-}Yuh Hwang and
Ronald Rosenfeld},
title = {An Overview of the {SPHINX-II} Speech Recognition System},
booktitle = {Human Language Technology: Proceedings of a Workshop Held at Plainsboro,
New Jersey, USA, March 21-24, 1993},
publisher = {Morgan Kaufmann},
year = {1993},
url = {https://aclanthology.org/H93-1016/},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/HuangAHR93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/LauRR93,
author = {Raymond Lau and
Ronald Rosenfeld and
Salim Roukos},
title = {Adaptive Language Modeling Using The Maximum Entropy Principle},
booktitle = {Human Language Technology: Proceedings of a Workshop Held at Plainsboro,
New Jersey, USA, March 21-24, 1993},
publisher = {Morgan Kaufmann},
year = {1993},
url = {https://aclanthology.org/H93-1021/},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/LauRR93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/RosenfeldHF92,
author = {Ronald Rosenfeld and
Xuedong Huang and
Merrick L. Furst},
title = {Exploiting correlations among competing models with application to
large vocabulary speech recognition},
booktitle = {1992 {IEEE} International Conference on Acoustics, Speech, and Signal
Processing, {ICASSP} '92, San Francisco, California, USA, March 23-26,
1992},
pages = {5--8},
publisher = {{IEEE} Computer Society},
year = {1992},
url = {https://doi.org/10.1109/ICASSP.1992.225986},
doi = {10.1109/ICASSP.1992.225986},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/RosenfeldHF92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/AllevaHHHRW92,
author = {Fil Alleva and
Hsiao{-}Wuen Hon and
Xuedong Huang and
Mei{-}Yuh Hwang and
Ronald Rosenfeld and
Robert Weide},
title = {Applying {SPHINX-II} to the {DARPA} Wall Street Journal {CSR} Task},
booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Harriman,
New York, USA, February 23-26, 1992},
publisher = {Morgan Kaufmann},
year = {1992},
url = {https://aclanthology.org/H92-1080/},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/AllevaHHHRW92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/RosenfeldH92,
author = {Ronald Rosenfeld and
Xuedong Huang},
title = {Improvements in Stochastic Language Modeling},
booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Harriman,
New York, USA, February 23-26, 1992},
publisher = {Morgan Kaufmann},
year = {1992},
url = {https://aclanthology.org/H92-1021/},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/RosenfeldH92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/PearlmutterR90,
author = {Barak A. Pearlmutter and
Ronald Rosenfeld},
editor = {Richard Lippmann and
John E. Moody and
David S. Touretzky},
title = {Chaitin-Kolmogorov Complexity and Generalization in Neural Networks},
booktitle = {Advances in Neural Information Processing Systems 3, {[NIPS} Conference,
Denver, Colorado, USA, November 26-29, 1990]},
pages = {925--931},
publisher = {Morgan Kaufmann},
year = {1990},
url = {http://papers.nips.cc/paper/394-chaitin-kolmogorov-complexity-and-generalization-in-neural-networks},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/PearlmutterR90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/compsys/RosenfeldT88,
author = {Ronald Rosenfeld and
David S. Touretzky},
title = {Coarse-Coded Symbol Memories and Their Properties},
journal = {Complex Syst.},
volume = {2},
number = {4},
year = {1988},
url = {http://www.complex-systems.com/abstracts/v02\_i04\_a04.html},
timestamp = {Fri, 11 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/compsys/RosenfeldT88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/RosenfeldT87,
author = {Ronald Rosenfeld and
David S. Touretzky},
editor = {Dana Z. Anderson},
title = {Scaling Properties of Coarse-Coded Symbol Memories},
booktitle = {Neural Information Processing Systems, Denver, Colorado, USA, 1987},
pages = {652--661},
publisher = {American Institue of Physics},
year = {1987},
url = {http://papers.nips.cc/paper/91-scaling-properties-of-coarse-coded-symbol-memories},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/RosenfeldT87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
last updated on 2024-04-03 22:48 CEST by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
