Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDBibTeX records: John M. Prager
@inproceedings{DBLP:conf/amia/LiangTDPJMPRP21,
author = {Jennifer J. Liang and
Ching{-}Huei Tsou and
Bharath Dandala and
Ananya Poddar and
Venkata Joopudi and
Diwakar Mahajan and
John M. Prager and
Preethi Raghavan and
Michele Payne},
title = {Reducing Physicians' Cognitive Load During Chart Review: {A} Problem-Oriented
Summary of the Patient Electronic Record},
booktitle = {{AMIA} 2021, American Medical Informatics Association Annual Symposium,
San Diego, CA, USA, October 30, 2021 - November 3, 2021},
publisher = {{AMIA}},
year = {2021},
url = {https://knowledge.amia.org/74229-amia-1.4622266/t003-1.4626466/t003-1.4626467/3577437-1.4626630/3576382-1.4626627},
timestamp = {Wed, 17 Apr 2024 11:46:53 +0200},
biburl = {https://dblp.org/rec/conf/amia/LiangTDPJMPRP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/LallyBBBCFGKMMP17,
author = {Adam Lally and
Sugato Bagchi and
Michael Barborak and
David W. Buchanan and
Jennifer Chu{-}Carroll and
David A. Ferrucci and
Michael R. Glass and
Aditya Kalyanpur and
Erik T. Mueller and
J. William Murdock and
Siddharth Patwardhan and
John M. Prager},
title = {WatsonPaths: Scenario-Based Question Answering and Inference over
Unstructured Information},
journal = {{AI} Mag.},
volume = {38},
number = {2},
pages = {59--76},
year = {2017},
url = {https://doi.org/10.1609/aimag.v38i2.2715},
doi = {10.1609/AIMAG.V38I2.2715},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/LallyBBBCFGKMMP17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cri/PragerLD17,
author = {John M. Prager and
Jennifer J. Liang and
Murthy V. Devarakonda},
title = {SemanticFind: Locating What You Want in a Patient Record, Not Just
What You Ask For},
booktitle = {Summit on Clinical Research Informatics, {CRI} 2017, San Francisco,
CA, USA, March 27-30, 2017},
publisher = {{AMIA}},
year = {2017},
url = {http://knowledge.amia.org/amia-64484-cri2017-1.3520710/t002-1.3521687/t002-1.3521688/a037-1.3521711/a038-1.3521708},
timestamp = {Wed, 20 Jun 2018 17:09:15 +0200},
biburl = {https://dblp.org/rec/conf/cri/PragerLD17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/TesauroGLFP14,
author = {Gerald Tesauro and
David Gondek and
Jonathan Lenchner and
James Fan and
John M. Prager},
title = {Analysis of Watson's Strategies for Playing Jeopardy!},
journal = {CoRR},
volume = {abs/1402.0571},
year = {2014},
url = {http://arxiv.org/abs/1402.0571},
eprinttype = {arXiv},
eprint = {1402.0571},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/TesauroGLFP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jair/TesauroGLFP13,
author = {Gerry Tesauro and
David Gondek and
Jonathan Lenchner and
James Fan and
John M. Prager},
title = {Analysis of Watson's Strategies for Playing Jeopardy!},
journal = {J. Artif. Intell. Res.},
volume = {47},
pages = {205--251},
year = {2013},
url = {https://doi.org/10.1613/jair.3834},
doi = {10.1613/JAIR.3834},
timestamp = {Mon, 21 Jan 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jair/TesauroGLFP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dke/FilatovaP12,
author = {Elena Filatova and
John M. Prager},
title = {Occupation inference through detection and classification of biographical
activities},
journal = {Data Knowl. Eng.},
volume = {76},
pages = {39--57},
year = {2012},
url = {https://doi.org/10.1016/j.datak.2012.04.001},
doi = {10.1016/J.DATAK.2012.04.001},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dke/FilatovaP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/LallyPMBPFFC12,
author = {Adam Lally and
John M. Prager and
Michael C. McCord and
Branimir Boguraev and
Siddharth Patwardhan and
James Fan and
Paul Fodor and
Jennifer Chu{-}Carroll},
title = {Question analysis: How Watson reads a clue},
journal = {{IBM} J. Res. Dev.},
volume = {56},
number = {3},
pages = {2},
year = {2012},
url = {https://doi.org/10.1147/JRD.2012.2184637},
doi = {10.1147/JRD.2012.2184637},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/LallyPMBPFFC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/KalyanpurBPMLWPCFZPQ12,
author = {Aditya Kalyanpur and
Branimir Boguraev and
Siddharth Patwardhan and
J. William Murdock and
Adam Lally and
Chris Welty and
John M. Prager and
Bonaventura Coppola and
Achille Fokoue{-}Nkoutche and
Lei Zhang and
Yue Pan and
Zhaoming Qiu},
title = {Structured data and inference in DeepQA},
journal = {{IBM} J. Res. Dev.},
volume = {56},
number = {3},
pages = {10},
year = {2012},
url = {https://doi.org/10.1147/JRD.2012.2188737},
doi = {10.1147/JRD.2012.2188737},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ibmrd/KalyanpurBPMLWPCFZPQ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/PragerBC12,
author = {John M. Prager and
Eric W. Brown and
Jennifer Chu{-}Carroll},
title = {Special Questions and techniques},
journal = {{IBM} J. Res. Dev.},
volume = {56},
number = {3},
pages = {11},
year = {2012},
url = {https://doi.org/10.1147/JRD.2012.2187392},
doi = {10.1147/JRD.2012.2187392},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/PragerBC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/TesauroGLFP12,
author = {Gerry Tesauro and
David Gondek and
Jon Lenchner and
James Fan and
John M. Prager},
title = {Simulation, learning, and optimization techniques in Watson's game
strategies},
journal = {{IBM} J. Res. Dev.},
volume = {56},
number = {3},
pages = {16},
year = {2012},
url = {https://doi.org/10.1147/JRD.2012.2188931},
doi = {10.1147/JRD.2012.2188931},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/TesauroGLFP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/FerrucciBCFGKLMNPSW10,
author = {David A. Ferrucci and
Eric W. Brown and
Jennifer Chu{-}Carroll and
James Fan and
David Gondek and
Aditya Kalyanpur and
Adam Lally and
J. William Murdock and
Eric Nyberg and
John M. Prager and
Nico Schlaefer and
Christopher A. Welty},
title = {Building Watson: An Overview of the DeepQA Project},
journal = {{AI} Mag.},
volume = {31},
number = {3},
pages = {59--79},
year = {2010},
url = {https://doi.org/10.1609/aimag.v31i3.2303},
doi = {10.1609/AIMAG.V31I3.2303},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/FerrucciBCFGKLMNPSW10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/Chu-CarrollP07,
author = {Jennifer Chu{-}Carroll and
John M. Prager},
editor = {M{\'{a}}rio J. Silva and
Alberto H. F. Laender and
Ricardo A. Baeza{-}Yates and
Deborah L. McGuinness and
Bj{\o}rn Olstad and
{\O}ystein Haug Olsen and
Andr{\'{e}} O. Falc{\~{a}}o},
title = {An experimental study of the impact of information extraction accuracy
on semantic search performance},
booktitle = {Proceedings of the Sixteenth {ACM} Conference on Information and Knowledge
Management, {CIKM} 2007, Lisbon, Portugal, November 6-10, 2007},
pages = {505--514},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1321440.1321512},
doi = {10.1145/1321440.1321512},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/Chu-CarrollP07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/PragerLC07,
author = {John M. Prager and
Sarah Luger and
Jennifer Chu{-}Carroll},
editor = {M{\'{a}}rio J. Silva and
Alberto H. F. Laender and
Ricardo A. Baeza{-}Yates and
Deborah L. McGuinness and
Bj{\o}rn Olstad and
{\O}ystein Haug Olsen and
Andr{\'{e}} O. Falc{\~{a}}o},
title = {Type nanotheories: a framework for term comparison},
booktitle = {Proceedings of the Sixteenth {ACM} Conference on Information and Knowledge
Management, {CIKM} 2007, Lisbon, Portugal, November 6-10, 2007},
pages = {701--710},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1321440.1321538},
doi = {10.1145/1321440.1321538},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/PragerLC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ftir/Prager06,
author = {John M. Prager},
title = {Open-Domain Question-Answering},
journal = {Found. Trends Inf. Retr.},
volume = {1},
number = {2},
pages = {91--231},
year = {2006},
url = {https://doi.org/10.1561/1500000001},
doi = {10.1561/1500000001},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ftir/Prager06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/PragerDC06,
author = {John M. Prager and
Pablo Ariel Duboue and
Jennifer Chu{-}Carroll},
editor = {Nicoletta Calzolari and
Claire Cardie and
Pierre Isabelle},
title = {Improving {QA} Accuracy by Question Inversion},
booktitle = {{ACL} 2006, 21st International Conference on Computational Linguistics
and 44th Annual Meeting of the Association for Computational Linguistics,
Proceedings of the Conference, Sydney, Australia, 17-21 July 2006},
publisher = {The Association for Computer Linguistics},
year = {2006},
url = {https://aclanthology.org/P06-1135/},
doi = {10.3115/1220175.1220310},
timestamp = {Sat, 21 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acl/PragerDC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/Chu-CarrollPCFD06,
author = {Jennifer Chu{-}Carroll and
John M. Prager and
Krzysztof Czuba and
David A. Ferrucci and
Pablo Ariel Duboue},
editor = {Efthimis N. Efthimiadis and
Susan T. Dumais and
David Hawking and
Kalervo J{\"{a}}rvelin},
title = {Semantic search via {XML} fragments: a high-precision approach to
{IR}},
booktitle = {{SIGIR} 2006: Proceedings of the 29th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, Seattle,
Washington, USA, August 6-11, 2006},
pages = {445--452},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1148170.1148247},
doi = {10.1145/1148170.1148247},
timestamp = {Sat, 21 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/Chu-CarrollPCFD06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/Chu-CarrollADGMPHW06,
author = {Jennifer Chu{-}Carroll and
Guillermo A. Averboch and
Pablo Ariel Duboue and
David Gondek and
J. William Murdock and
John M. Prager and
Paul Hoffmann and
Janyce Wiebe},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {{IBM} in {TREC} 2006 Enterprise Track},
booktitle = {Proceedings of the Fifteenth Text REtrieval Conference, {TREC} 2006,
Gaithersburg, Maryland, USA, November 14-17, 2006},
series = {{NIST} Special Publication},
volume = {500-272},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2006},
url = {http://trec.nist.gov/pubs/trec15/papers/ibm-watson.ent.final.pdf},
timestamp = {Sat, 21 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/trec/Chu-CarrollADGMPHW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/FilatovaP05,
author = {Elena Filatova and
John M. Prager},
title = {Tell Me What You Do and I'll Tell You What You Are: Learning Occupation-Related
Activities for Biographies},
booktitle = {{HLT/EMNLP} 2005, Human Language Technology Conference and Conference
on Empirical Methods in Natural Language Processing, Proceedings of
the Conference, 6-8 October 2005, Vancouver, British Columbia, Canada},
pages = {113--120},
publisher = {The Association for Computational Linguistics},
year = {2005},
url = {https://aclanthology.org/H05-1015/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/FilatovaP05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/Chu-CarrollDPC05,
author = {Jennifer Chu{-}Carroll and
Pablo Ariel Duboue and
John M. Prager and
Krzysztof Czuba},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {IBM's {PIQUANT} {II} in {TREC} 2005},
booktitle = {Proceedings of the Fourteenth Text REtrieval Conference, {TREC} 2005,
Gaithersburg, Maryland, USA, November 15-18, 2005},
series = {{NIST} Special Publication},
volume = {500-266},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2005},
url = {http://trec.nist.gov/pubs/trec14/papers/ibm.tjwatson.qa.prager.pdf},
timestamp = {Sat, 21 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/trec/Chu-CarrollDPC05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/PragerCC04,
author = {John M. Prager and
Jennifer Chu{-}Carroll and
Krzysztof Czuba},
editor = {Donia Scott and
Walter Daelemans and
Marilyn A. Walker},
title = {Question Answering Using Constraint Satisfaction: QA-By-Dossier-With-Contraints},
booktitle = {Proceedings of the 42nd Annual Meeting of the Association for Computational
Linguistics, 21-26 July, 2004, Barcelona, Spain},
pages = {574--581},
publisher = {{ACL}},
year = {2004},
url = {https://aclanthology.org/P04-1073/},
doi = {10.3115/1218955.1219028},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/PragerCC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ndqa/PragerCC04,
author = {John M. Prager and
Jennifer Chu{-}Carroll and
Krzysztof Czuba},
editor = {Mark T. Maybury},
title = {A Multi-Agent Approach to Using Redundancy and Reinforcement in Question
Answering},
booktitle = {New Directions in Question Answering},
pages = {237--252},
publisher = {{AAAI} Press},
year = {2004},
timestamp = {Tue, 14 Dec 2004 12:09:54 +0100},
biburl = {https://dblp.org/rec/conf/ndqa/PragerCC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/Chu-CarrollCPIB04,
author = {Jennifer Chu{-}Carroll and
Krzysztof Czuba and
John M. Prager and
Abraham Ittycheriah and
Sasha Blair{-}Goldensohn},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {IBM's {PIQUANT} {II} in {TREC} 2004},
booktitle = {Proceedings of the Thirteenth Text REtrieval Conference, {TREC} 2004,
Gaithersburg, Maryland, USA, November 16-19, 2004},
series = {{NIST} Special Publication},
volume = {500-261},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2004},
url = {http://trec.nist.gov/pubs/trec13/papers/ibm-prager.qa.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/Chu-CarrollCPIB04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003},
url = {https://doi.org/10.1145/945546.945549},
doi = {10.1145/945546.945549},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/Chu-CarrollCPI03,
author = {Jennifer Chu{-}Carroll and
Krzysztof Czuba and
John M. Prager and
Abraham Ittycheriah},
editor = {Marti A. Hearst and
Mari Ostendorf},
title = {In Question Answering, Two Heads Are Better Than One},
booktitle = {Human Language Technology Conference of the North American Chapter
of the Association for Computational Linguistics, {HLT-NAACL} 2003,
Edmonton, Canada, May 27 - June 1, 2003},
publisher = {The Association for Computational Linguistics},
year = {2003},
url = {https://aclanthology.org/N03-1004/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/Chu-CarrollCPI03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ndqa/Chu-CarrollFPW03,
author = {Jennifer Chu{-}Carroll and
David A. Ferrucci and
John M. Prager and
Christopher A. Welty},
editor = {Mark T. Maybury},
title = {Hybridization in Question Answering Systems},
booktitle = {New Directions in Question Answering, Papers from 2003 {AAAI} Spring
Symposium, Stanford University, Stanford, CA, {USA}},
pages = {116--121},
publisher = {{AAAI} Press},
year = {2003},
timestamp = {Mon, 10 Jan 2005 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ndqa/Chu-CarrollFPW03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/PragerCCWIM03,
author = {John M. Prager and
Jennifer Chu{-}Carroll and
Krzysztof Czuba and
Christopher A. Welty and
Abraham Ittycheriah and
Ruchi Mahindru},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {IBM's {PIQUANT} in {TREC2003}},
booktitle = {Proceedings of The Twelfth Text REtrieval Conference, {TREC} 2003,
Gaithersburg, Maryland, USA, November 18-21, 2003},
series = {{NIST} Special Publication},
volume = {500-255},
pages = {283--292},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2003},
url = {http://trec.nist.gov/pubs/trec12/papers/ibm-prager.qa.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/PragerCCWIM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/Chu-CarrollPRC02,
author = {Jennifer Chu{-}Carroll and
John M. Prager and
Yael Ravin and
Christian Cesar},
title = {A Hybrid Approach to Natural Language Web Search},
booktitle = {Proceedings of the 2002 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2002, Philadelphia, PA, USA, July 6-7,
2002},
pages = {180--187},
year = {2002},
url = {https://aclanthology.org/W02-1024/},
doi = {10.3115/1118693.1118717},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/Chu-CarrollPRC02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/CzubaPC02,
author = {Krzysztof Czuba and
John M. Prager and
Jennifer Chu{-}Carroll},
title = {A Machine-Learning Approach to Introspection in a Question Answering
System},
booktitle = {Proceedings of the 2002 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2002, Philadelphia, PA, USA, July 6-7,
2002},
pages = {265--272},
year = {2002},
url = {https://aclanthology.org/W02-1034/},
doi = {10.3115/1118693.1118727},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/CzubaPC02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/Chu-CarrollPWCF02,
author = {Jennifer Chu{-}Carroll and
John M. Prager and
Christopher A. Welty and
Krzysztof Czuba and
David A. Ferrucci},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {A Multi-Strategy and Multi-Source Approach to Question Answering},
booktitle = {Proceedings of The Eleventh Text REtrieval Conference, {TREC} 2002,
Gaithersburg, Maryland, USA, November 19-22, 2002},
series = {{NIST} Special Publication},
volume = {500-251},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2002},
url = {http://trec.nist.gov/pubs/trec11/papers/ibm.prager.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/Chu-CarrollPWCF02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/RadevQZBZFP01,
author = {Dragomir R. Radev and
Hong Qi and
Zhiping Zheng and
Sasha Blair{-}Goldensohn and
Zhu Zhang and
Weiguo Fan and
John M. Prager},
title = {Mining the Web for Answers to Natural Language Questions},
booktitle = {Proceedings of the 2001 {ACM} {CIKM} International Conference on Information
and Knowledge Management, Atlanta, Georgia, USA, November 5-10, 2001},
pages = {143--150},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/502585.502610},
doi = {10.1145/502585.502610},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/RadevQZBZFP01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/PragerRC01,
author = {John M. Prager and
Dragomir R. Radev and
Krzysztof Czuba},
title = {Answering What-Is Questions by Virtual Annotation},
booktitle = {Proceedings of the First International Conference on Human Language
Technology Research, {HLT} 2001, San Diego, California, USA, March
18-21, 2001},
publisher = {Morgan Kaufmann},
year = {2001},
url = {https://aclanthology.org/H01-1006/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/PragerRC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/PragerCC01,
author = {John M. Prager and
Jennifer Chu{-}Carroll and
Krzysztof Czuba},
editor = {Ellen M. Voorhees and
Donna K. Harman},
title = {Use of WordNet Hypernyms for Answering What-Is Questions},
booktitle = {Proceedings of The Tenth Text REtrieval Conference, {TREC} 2001, Gaithersburg,
Maryland, USA, November 13-16, 2001},
series = {{NIST} Special Publication},
volume = {500-250},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2001},
url = {http://trec.nist.gov/pubs/trec10/papers/Trec10NotebookPrager.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/PragerCC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmis/Prager00,
author = {John M. Prager},
title = {Linguini: Language Identification for Multilingual Documents},
journal = {J. Manag. Inf. Syst.},
volume = {16},
number = {3},
pages = {71--102},
year = {2000},
url = {https://doi.org/10.1080/07421222.1999.11518257},
doi = {10.1080/07421222.1999.11518257},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmis/Prager00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anlp/RadevPS00,
author = {Dragomir R. Radev and
John M. Prager and
Valerie Samn},
title = {Ranking suspected answers to natural language questions using predictive
annotation},
booktitle = {6th Applied Natural Language Processing Conference, {ANLP} 2000, Seattle,
Washington, USA, April 29 - May 4, 2000},
pages = {150--157},
publisher = {{ACL}},
year = {2000},
url = {https://aclanthology.org/A00-1021/},
doi = {10.3115/974147.974168},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/anlp/RadevPS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/CooperP00,
author = {James W. Cooper and
John M. Prager},
title = {Anti-Serendipity: Finding Useless Documents and Similar Documents},
booktitle = {33rd Annual Hawaii International Conference on System Sciences (HICSS-33),
4-7 January, 2000, Maui, Hawaii, {USA}},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/HICSS.2000.926691},
doi = {10.1109/HICSS.2000.926691},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/CooperP00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/PragerBCR00,
author = {John M. Prager and
Eric W. Brown and
Anni Coden and
Dragomir R. Radev},
editor = {Emmanuel J. Yannakoudakis and
Nicholas J. Belkin and
Peter Ingwersen and
Mun{-}Kew Leong},
title = {Question-answering by predictive annotation},
booktitle = {{SIGIR} 2000: Proceedings of the 23rd Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, July
24-28, 2000, Athens, Greece},
pages = {184--191},
publisher = {{ACM}},
year = {2000},
url = {https://doi.org/10.1145/345508.345574},
doi = {10.1145/345508.345574},
timestamp = {Tue, 06 Nov 2018 11:07:24 +0100},
biburl = {https://dblp.org/rec/conf/sigir/PragerBCR00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/PragerBRC00,
author = {John M. Prager and
Eric W. Brown and
Dragomir R. Radev and
Krzysztof Czuba},
editor = {Ellen M. Voorhees and
Donna K. Harman},
title = {One Search Engine or Two for Question-Answering},
booktitle = {Proceedings of The Ninth Text REtrieval Conference, {TREC} 2000, Gaithersburg,
Maryland, USA, November 13-16, 2000},
series = {{NIST} Special Publication},
volume = {500-249},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2000},
url = {http://trec.nist.gov/pubs/trec9/papers/PragerTrec9notebook.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/PragerBRC00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cs-CL-0005029,
author = {Dragomir R. Radev and
John M. Prager and
Valerie Samn},
title = {Ranking suspected answers to natural language questions using predictive
annotation},
journal = {CoRR},
volume = {cs.CL/0005029},
year = {2000},
url = {https://arxiv.org/abs/cs/0005029},
timestamp = {Fri, 10 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/cs-CL-0005029.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/Prager99,
author = {John M. Prager},
title = {Linguini: Language Identification for Multilingual Documents},
booktitle = {32nd Annual Hawaii International Conference on System Sciences (HICSS-32),
January 5-8, 1999, Maui, Hawaii, {USA}},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/HICSS.1999.772689},
doi = {10.1109/HICSS.1999.772689},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/Prager99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/PragerRBCS99,
author = {John M. Prager and
Dragomir R. Radev and
Eric W. Brown and
Anni Coden and
Valerie Samn},
editor = {Ellen M. Voorhees and
Donna K. Harman},
title = {The Use of Predictive Annotation for Question Answering in {TREC8}},
booktitle = {Proceedings of The Eighth Text REtrieval Conference, {TREC} 1999,
Gaithersburg, Maryland, USA, November 17-19, 1999},
series = {{NIST} Special Publication},
volume = {500-246},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {1999},
url = {http://trec.nist.gov/pubs/trec8/papers/IBMTrec8QA.ps},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/PragerRBCS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmsj/PragerLGB90,
author = {John M. Prager and
Donna M. Lamberti and
David L. Gardner and
Stephen R. Balzac},
title = {{REASON:} An Intelligent User Assistant for Interactive Environments},
journal = {{IBM} Syst. J.},
volume = {29},
number = {1},
pages = {141--164},
year = {1990},
url = {https://doi.org/10.1147/sj.291.0141},
doi = {10.1147/SJ.291.0141},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmsj/PragerLGB90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cvgip/PragerA83,
author = {John M. Prager and
Michael A. Arbib},
title = {Computing the optic flow: The {MATCH} algorithm and prediction},
journal = {Comput. Vis. Graph. Image Process.},
volume = {24},
number = {3},
pages = {271--304},
year = {1983},
url = {https://doi.org/10.1016/0734-189X(83)90057-9},
doi = {10.1016/0734-189X(83)90057-9},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cvgip/PragerA83.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmsj/Prager83,
author = {John M. Prager},
title = {The Project Automated Librarian},
journal = {{IBM} Syst. J.},
volume = {22},
number = {3},
pages = {214--228},
year = {1983},
url = {https://doi.org/10.1147/sj.223.0214},
doi = {10.1147/SJ.223.0214},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmsj/Prager83.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/Prager80,
author = {John M. Prager},
title = {Extracting and Labeling Boundary Segments in Natural Scenes},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {2},
number = {1},
pages = {16--27},
year = {1980},
url = {https://doi.org/10.1109/TPAMI.1980.4766966},
doi = {10.1109/TPAMI.1980.4766966},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pami/Prager80.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
last updated on 2024-04-18 22:53 CEST by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
