Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDBibTeX records: Ming Liu
@article{DBLP:journals/aisy/LiWWDMZZLZLXYZLIL24,
author = {Yang Li and
Wei Wang and
Ming Wang and
Chunmeng Dou and
Zhengyu Ma and
Huihui Zhou and
Peng Zhang and
Nicola Lepri and
Xumeng Zhang and
Qing Luo and
Xiaoxin Xu and
Guanhua Yang and
Feng Zhang and
Ling Li and
Daniele Ielmini and
Ming Liu},
title = {Binary-Stochasticity-Enabled Highly Efficient Neuromorphic Deep Learning
Achieves Better-than-Software Accuracy},
journal = {Adv. Intell. Syst.},
volume = {6},
number = {1},
year = {2024},
url = {https://doi.org/10.1002/aisy.202300399},
doi = {10.1002/AISY.202300399},
timestamp = {Tue, 16 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aisy/LiWWDMZZLZLXYZLIL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/apjor/ZhengCLX24,
author = {Feifeng Zheng and
Yuhong Chen and
Ming Liu and
Yinfeng Xu},
title = {Semi-Online Scheduling on Two Identical Parallel Machines with Initial-Lookahead
Information},
journal = {Asia Pac. J. Oper. Res.},
volume = {41},
number = {1},
pages = {2350003:1--2350003:20},
year = {2024},
url = {https://doi.org/10.1142/S0217595923500033},
doi = {10.1142/S0217595923500033},
timestamp = {Mon, 18 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/apjor/ZhengCLX24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/axioms/ChenLX24,
author = {Hengfei Chen and
Ming Liu and
Xiaofeng Xu},
title = {Dynamics of a Prey-Predator Model with Group Defense for Prey, Cooperative
Hunting for Predator, and L{\'{e}}vy Jump},
journal = {Axioms},
volume = {12},
number = {9},
pages = {878},
year = {2024},
url = {https://doi.org/10.3390/axioms12090878},
doi = {10.3390/AXIOMS12090878},
timestamp = {Wed, 24 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/axioms/ChenLX24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/compsec/LiuSLL24,
author = {Ming Liu and
Xiao Song and
Yong Li and
Wenxin Li},
title = {Correlated differential privacy based logistic regression for supplier
data protection},
journal = {Comput. Secur.},
volume = {136},
pages = {103542},
year = {2024},
url = {https://doi.org/10.1016/j.cose.2023.103542},
doi = {10.1016/J.COSE.2023.103542},
timestamp = {Fri, 12 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/compsec/LiuSLL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cor/DaiLCL24,
author = {Wenqiang Dai and
Min Liu and
Chengbin Chu and
Ming Liu},
title = {Robust optimization for spread quality and shortfall in guaranteed
targeted display advertising planning},
journal = {Comput. Oper. Res.},
volume = {161},
pages = {106421},
year = {2024},
url = {https://doi.org/10.1016/j.cor.2023.106421},
doi = {10.1016/J.COR.2023.106421},
timestamp = {Mon, 04 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cor/DaiLCL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/YiDLHKZ24,
author = {Weichao Yi and
Liquan Dong and
Ming Liu and
Mei Hui and
Lingqin Kong and
Yuejin Zhao},
title = {Towards Compact Single Image Dehazing via Task-related Contrastive
Network},
journal = {Expert Syst. Appl.},
volume = {235},
pages = {121130},
year = {2024},
url = {https://doi.org/10.1016/j.eswa.2023.121130},
doi = {10.1016/J.ESWA.2023.121130},
timestamp = {Thu, 09 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eswa/YiDLHKZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/evi/QuFWLZ24,
author = {Chongxiao Qu and
Changjun Fan and
Yufeng Wang and
Ming Liu and
Yongjin Zhang},
title = {A game theory based approach for distributed dynamic spectrum access},
journal = {Evol. Intell.},
volume = {17},
number = {1},
pages = {275--282},
year = {2024},
url = {https://doi.org/10.1007/s12065-022-00709-y},
doi = {10.1007/S12065-022-00709-Y},
timestamp = {Fri, 01 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/evi/QuFWLZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijns/LengZYYLLLGSHYFWZXX24,
author = {Jiancai Leng and
Jianqun Zhu and
Yihao Yan and
Xin Yu and
Ming Liu and
Yitai Lou and
Yanbing Liu and
Licai Gao and
Yuan Sun and
Tianzheng He and
Qingbo Yang and
Chao Feng and
Dezheng Wang and
Yang Zhang and
Qing Xu and
Fangzhou Xu},
title = {Multilevel Laser-Induced Pain Measurement with Wasserstein Generative
Adversarial Network - Gradient Penalty Model},
journal = {Int. J. Neural Syst.},
volume = {34},
number = {1},
pages = {2350067:1--2350067:20},
year = {2024},
url = {https://doi.org/10.1142/S0129065723500673},
doi = {10.1142/S0129065723500673},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijns/LengZYYLLLGSHYFWZXX24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcloudc/YangDLXTLL24,
author = {Kai Yang and
Jiawei Du and
Jingchao Liu and
Feng Xu and
Ye Tang and
Ming Liu and
Zhibin Li},
title = {{FLM-ICR:} a federated learning model for classification of internet
of vehicle terminals using connection records},
journal = {J. Cloud Comput.},
volume = {13},
number = {1},
pages = {57},
year = {2024},
url = {https://doi.org/10.1186/s13677-024-00623-x},
doi = {10.1186/S13677-024-00623-X},
timestamp = {Thu, 21 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcloudc/YangDLXTLL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcloudc/YangDLXTLL24a,
author = {Kai Yang and
Jiawei Du and
Jingchao Liu and
Feng Xu and
Ye Tang and
Ming Liu and
Zhibin Li},
title = {Correction: {FLM-ICR:} a federated learning model for classification
of internet of vehicle terminals using connection records},
journal = {J. Cloud Comput.},
volume = {13},
number = {1},
pages = {75},
year = {2024},
url = {https://doi.org/10.1186/s13677-024-00638-4},
doi = {10.1186/S13677-024-00638-4},
timestamp = {Sat, 30 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcloudc/YangDLXTLL24a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/XiaQLL24,
author = {Qing Xia and
Shi Qiu and
Ming Liu and
Xiaohui Lin},
title = {Task planning of space debris removal based on a hierarchical exploration
artificial bee colony algorithm},
journal = {Neural Comput. Appl.},
volume = {36},
number = {12},
pages = {6597--6612},
year = {2024},
url = {https://doi.org/10.1007/s00521-023-09399-8},
doi = {10.1007/S00521-023-09399-8},
timestamp = {Wed, 10 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nca/XiaQLL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/JiangZLT24,
author = {Xiaohua Jiang and
Xiaoxiao Zhang and
Ming Liu and
Jie Tian},
title = {Joint Panchromatic and Multispectral Geometric Calibration Method
for the {DS-1} Satellite},
journal = {Remote. Sens.},
volume = {16},
number = {2},
pages = {433},
year = {2024},
url = {https://doi.org/10.3390/rs16020433},
doi = {10.3390/RS16020433},
timestamp = {Wed, 31 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/remotesensing/JiangZLT24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/YinLCLW24,
author = {Boshuo Yin and
Furong Liu and
Qingyuan Chen and
Ming Liu and
Feiying Wang},
title = {Flexible Strain Sensors Based on Bionic Parallel Vein-like Structures
for Human Motion Monitoring},
journal = {Sensors},
volume = {24},
number = {2},
pages = {468},
year = {2024},
url = {https://doi.org/10.3390/s24020468},
doi = {10.3390/S24020468},
timestamp = {Thu, 29 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/YinLCLW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/MaZPL24,
author = {Xianping Ma and
Xiaokang Zhang and
Man{-}On Pun and
Ming Liu},
title = {A Multilevel Multimodal Fusion Transformer for Remote Sensing Semantic
Segmentation},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {62},
pages = {1--15},
year = {2024},
url = {https://doi.org/10.1109/TGRS.2024.3373033},
doi = {10.1109/TGRS.2024.3373033},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/MaZPL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/ZhaoDLKCHZ24,
author = {Qisen Zhao and
Liquan Dong and
Ming Liu and
Lingqin Kong and
Xuhong Chu and
Mei Hui and
Yuejin Zhao},
title = {Visible/Infrared Image Registration Based on Region-Adaptive Contextual
Multifeatures},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {62},
pages = {1--17},
year = {2024},
url = {https://doi.org/10.1109/TGRS.2024.3385088},
doi = {10.1109/TGRS.2024.3385088},
timestamp = {Mon, 22 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/ZhaoDLKCHZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tii/TanHGLL24,
author = {Shouhong Tan and
Fengrui Hao and
Tianlong Gu and
Long Li and
Ming Liu},
title = {Collusive Model Poisoning Attack in Decentralized Federated Learning},
journal = {{IEEE} Trans. Ind. Informatics},
volume = {20},
number = {4},
pages = {5989--5999},
year = {2024},
url = {https://doi.org/10.1109/TII.2023.3342901},
doi = {10.1109/TII.2023.3342901},
timestamp = {Mon, 15 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tii/TanHGLL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/LiuLYSDK24,
author = {Yuxue Liu and
Ming Liu and
Yuzhang Yan and
Shilei Sun and
Liquan Dong and
Lingqin Kong},
title = {Calibration Method for Wide-Field Machine Vision System Based on Laser
Projection Turntable},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {73},
pages = {1--12},
year = {2024},
url = {https://doi.org/10.1109/TIM.2024.3381283},
doi = {10.1109/TIM.2024.3381283},
timestamp = {Mon, 15 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tim/LiuLYSDK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/TanSZWWPXLC24,
author = {Zhiwei Tan and
Fei Shi and
Yi Zhou and
Jingcheng Wang and
Meng Wang and
Yuanyuan Peng and
Kai Xu and
Ming Liu and
Xinjian Chen},
title = {A Multi-Scale Fusion and Transformer Based Registration Guided Speckle
Noise Reduction for {OCT} Images},
journal = {{IEEE} Trans. Medical Imaging},
volume = {43},
number = {1},
pages = {473--488},
year = {2024},
url = {https://doi.org/10.1109/TMI.2023.3309813},
doi = {10.1109/TMI.2023.3309813},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tmi/TanSZWWPXLC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/vc/YiDLHKZ24,
author = {Weichao Yi and
Liquan Dong and
Ming Liu and
Mei Hui and
Lingqin Kong and
Yuejin Zhao},
title = {MFAF-Net: image dehazing with multi-level features and adaptive fusion},
journal = {Vis. Comput.},
volume = {40},
number = {4},
pages = {2293--2307},
year = {2024},
url = {https://doi.org/10.1007/s00371-023-02917-8},
doi = {10.1007/S00371-023-02917-8},
timestamp = {Sun, 14 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/vc/YiDLHKZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccwc/LiuZ24,
author = {Ming Liu and
Qingxue Zhang},
editor = {Rajashree Paul and
Arpita Kundu},
title = {Spatial Variability Learning of Biomechanical Dynamics in Daily Lives},
booktitle = {14th {IEEE} Annual Computing and Communication Workshop and Conference,
{CCWC} 2024, Las Vegas, NV, USA, January 8-10, 2024},
pages = {626--629},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/CCWC60891.2024.10427611},
doi = {10.1109/CCWC60891.2024.10427611},
timestamp = {Thu, 29 Feb 2024 09:18:18 +0100},
biburl = {https://dblp.org/rec/conf/ccwc/LiuZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/LiLYYQLX24,
author = {Jiaxiang Li and
Zimu Li and
Yun Yin and
Changgu Yan and
Nan Qi and
Ming Liu and
Hongtao Xu},
title = {4.4 {A} Highly-Integrated 6-Phase Cell-Reused Digital Transmitter
Using 1/3 Duty-Cycle {LO} Signals for Harmonic Rejection},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2024,
San Francisco, CA, USA, February 18-22, 2024},
pages = {82--84},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISSCC49657.2024.10454514},
doi = {10.1109/ISSCC49657.2024.10454514},
timestamp = {Tue, 19 Mar 2024 09:04:31 +0100},
biburl = {https://dblp.org/rec/conf/isscc/LiLYYQLX24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/WangLZGLYHLYYLDLL24,
author = {Linfang Wang and
Weizeng Li and
Zhidao Zhou and
Hanghang Gao and
Zhi Li and
Wang Ye and
Hongyang Hu and
Jing Liu and
Jinshan Yue and
Jianguo Yang and
Qing Luo and
Chunmeng Dou and
Qi Liu and
Ming Liu},
title = {34.9 {A} Flash-SRAM-ADC-Fused Plastic Computing-in-Memory Macro for
Learning in Neural Networks in a Standard 14nm FinFET Process},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2024,
San Francisco, CA, USA, February 18-22, 2024},
pages = {582--584},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISSCC49657.2024.10454372},
doi = {10.1109/ISSCC49657.2024.10454372},
timestamp = {Tue, 19 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/WangLZGLYHLYYLDLL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nsdi/HouZWL24,
author = {Wentao Hou and
Jie Zhang and
Zeke Wang and
Ming Liu},
editor = {Laurent Vanbever and
Irene Zhang},
title = {Understanding Routable PCIe Performance for Composable Infrastructures},
booktitle = {21st {USENIX} Symposium on Networked Systems Design and Implementation,
{NSDI} 2024, Santa Clara, CA, April 15-17, 2024},
pages = {297--312},
publisher = {{USENIX} Association},
year = {2024},
url = {https://www.usenix.org/conference/nsdi24/presentation/hou},
timestamp = {Fri, 19 Apr 2024 11:29:16 +0200},
biburl = {https://dblp.org/rec/conf/nsdi/HouZWL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2401-02673,
author = {Dongdi Zhao and
Jianbo Ma and
Lu Lu and
Jinke Li and
Xuan Ji and
Lei Zhu and
Fuming Fang and
Ming Liu and
Feijun Jiang},
title = {A unified multichannel far-field speech recognition system: combining
neural beamforming with attention based end-to-end model},
journal = {CoRR},
volume = {abs/2401.02673},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2401.02673},
doi = {10.48550/ARXIV.2401.02673},
eprinttype = {arXiv},
eprint = {2401.02673},
timestamp = {Thu, 25 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2401-02673.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2401-03203,
author = {Tongyan Hua and
Haotian Bai and
Zidong Cao and
Ming Liu and
Dacheng Tao and
Lin Wang},
title = {Hi-Map: Hierarchical Factorized Radiance Field for High-Fidelity Monocular
Dense Mapping},
journal = {CoRR},
volume = {abs/2401.03203},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2401.03203},
doi = {10.48550/ARXIV.2401.03203},
eprinttype = {arXiv},
eprint = {2401.03203},
timestamp = {Wed, 24 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2401-03203.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2401-08438,
author = {Yaojia Lv and
Haojie Pan and
Ruiji Fu and
Ming Liu and
Zhongyuan Wang and
Bing Qin},
title = {CogGPT: Unleashing the Power of Cognitive Dynamics on Large Language
Models},
journal = {CoRR},
volume = {abs/2401.08438},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2401.08438},
doi = {10.48550/ARXIV.2401.08438},
eprinttype = {arXiv},
eprint = {2401.08438},
timestamp = {Thu, 01 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2401-08438.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2401-17083,
author = {Kangcheng Liu and
Xinhu Zheng and
Chaoqun Wang and
Hesheng Wang and
Ming Liu and
Kai Tang},
title = {Online Robot Navigation and and Manipulation with Distilled Vision-Language
Models},
journal = {CoRR},
volume = {abs/2401.17083},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2401.17083},
doi = {10.48550/ARXIV.2401.17083},
eprinttype = {arXiv},
eprint = {2401.17083},
timestamp = {Wed, 07 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2401-17083.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-03041,
author = {Xuzheng Chen and
Jie Zhang and
Ting Fu and
Yifan Shen and
Shu Ma and
Kun Qian and
Lingjun Zhu and
Chao Shi and
Yin Zhang and
Ming Liu and
Zeke Wang},
title = {Demystifying Datapath Accelerator Enhanced Off-path SmartNIC},
journal = {CoRR},
volume = {abs/2402.03041},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.03041},
doi = {10.48550/ARXIV.2402.03041},
eprinttype = {arXiv},
eprint = {2402.03041},
timestamp = {Mon, 26 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-03041.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-11790,
author = {Shipeng Zhong and
Hongbo Chen and
Yuhua Qi and
Dapeng Feng and
Zhiqiang Chen and
Jin Wu and
Weisong Wen and
Ming Liu},
title = {CoLRIO: LiDAR-Ranging-Inertial Centralized State Estimation for Robotic
Swarms},
journal = {CoRR},
volume = {abs/2402.11790},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.11790},
doi = {10.48550/ARXIV.2402.11790},
eprinttype = {arXiv},
eprint = {2402.11790},
timestamp = {Mon, 26 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-11790.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-18934,
author = {Zhiqiang Chen and
Hongbo Chen and
Yuhua Qi and
Shipeng Zhong and
Dapeng Feng and
Jin Wu and
Weisong Wen and
Ming Liu},
title = {{RELEAD:} Resilient Localization with Enhanced LiDAR Odometry in Adverse
Environments},
journal = {CoRR},
volume = {abs/2402.18934},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.18934},
doi = {10.48550/ARXIV.2402.18934},
eprinttype = {arXiv},
eprint = {2402.18934},
timestamp = {Tue, 26 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-18934.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-16880,
author = {Tianshuai Hu and
Jianhao Jiao and
Yucheng Xu and
Hongji Liu and
Sheng Wang and
Ming Liu},
title = {DHP-Mapping: {A} Dense Panoptic Mapping System with Hierarchical World
Representation and Label Optimization Techniques},
journal = {CoRR},
volume = {abs/2403.16880},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.16880},
doi = {10.48550/ARXIV.2403.16880},
eprinttype = {arXiv},
eprint = {2403.16880},
timestamp = {Tue, 09 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-16880.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ZhouLLW23,
author = {Wenkai Zhou and
Ming Liu and
Tenghui Liu and
Yue Wang},
title = {Influence of Bus Bay on Heterogeneous Traffic Flow Consisting of Human
Driving and Autonomous Vehicles},
journal = {{IEEE} Access},
volume = {11},
pages = {89455--89468},
year = {2023},
url = {https://doi.org/10.1109/ACCESS.2023.3307590},
doi = {10.1109/ACCESS.2023.3307590},
timestamp = {Thu, 14 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/ZhouLLW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aeog/LiuZMLM23,
author = {Ming Liu and
Gaoxiang Zhou and
Lingfei Ma and
Liangzhi Li and
Qiong Mei},
title = {SIFNet: {A} self-attention interaction fusion network for multisource
satellite imagery template matching},
journal = {Int. J. Appl. Earth Obs. Geoinformation},
volume = {118},
pages = {103247},
year = {2023},
url = {https://doi.org/10.1016/j.jag.2023.103247},
doi = {10.1016/J.JAG.2023.103247},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aeog/LiuZMLM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/apin/YangKLTDZCH23,
author = {Peng Yang and
Lingqin Kong and
Ming Liu and
Ge Tang and
Liquan Dong and
Yuejin Zhao and
Xuhong Chu and
Mei Hui},
title = {Response index: quantitative evaluation index of translational equivariance},
journal = {Appl. Intell.},
volume = {53},
number = {23},
pages = {28642--28654},
year = {2023},
url = {https://doi.org/10.1007/s10489-023-05021-5},
doi = {10.1007/S10489-023-05021-5},
timestamp = {Sun, 10 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/apin/YangKLTDZCH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bib/LiuZXLLLGLTYZ23,
author = {Mingzhu Liu and
Jian Zhou and
Qilemuge Xi and
Yuchao Liang and
Haicheng Li and
Pengfei Liang and
Yuting Guo and
Ming Liu and
Temuqile Temuqile and
Lei Yang and
Yongchun Zuo},
title = {A computational framework of routine test data for the cost-effective
chronic disease prediction},
journal = {Briefings Bioinform.},
volume = {24},
number = {2},
year = {2023},
url = {https://doi.org/10.1093/bib/bbad054},
doi = {10.1093/BIB/BBAD054},
timestamp = {Sat, 29 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bib/LiuZXLLLGLTYZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cnsns/MaHZML23,
author = {Linyi Ma and
Dongpo Hu and
Zhaowen Zheng and
Cui{-}Qin Ma and
Ming Liu},
title = {Multiple bifurcations in a mathematical model of glioma-immune interaction},
journal = {Commun. Nonlinear Sci. Numer. Simul.},
volume = {123},
pages = {107282},
year = {2023},
url = {https://doi.org/10.1016/j.cnsns.2023.107282},
doi = {10.1016/J.CNSNS.2023.107282},
timestamp = {Sun, 25 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cnsns/MaHZML23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/displays/YiDLHKZ23,
author = {Weichao Yi and
Liquan Dong and
Ming Liu and
Mei Hui and
Lingqin Kong and
Yuejin Zhao},
title = {Frequency-guidance Collaborative Triple-branch Network for single
image dehazing},
journal = {Displays},
volume = {80},
pages = {102577},
year = {2023},
url = {https://doi.org/10.1016/j.displa.2023.102577},
doi = {10.1016/J.DISPLA.2023.102577},
timestamp = {Sat, 20 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/displays/YiDLHKZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eor/LiSLY23,
author = {Yuchen Li and
Francisco Saldanha{-}da{-}Gama and
Ming Liu and
Zaoli Yang},
title = {A risk-averse two-stage stochastic programming model for a joint multi-item
capacitated line balancing and lot-sizing problem},
journal = {Eur. J. Oper. Res.},
volume = {304},
number = {1},
pages = {353--365},
year = {2023},
url = {https://doi.org/10.1016/j.ejor.2021.09.043},
doi = {10.1016/J.EJOR.2021.09.043},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eor/LiSLY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/LiuWL23,
author = {Hao Liu and
Mingjiang Wang and
Ming Liu},
title = {{QIAD:} {A} quadratic interpolation approximate divider},
journal = {{IEICE} Electron. Express},
volume = {20},
number = {11},
pages = {20230167},
year = {2023},
url = {https://doi.org/10.1587/elex.20.20230167},
doi = {10.1587/ELEX.20.20230167},
timestamp = {Tue, 25 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieiceee/LiuWL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijfs/LiuLSQ23,
author = {Ruixia Liu and
Ming Liu and
Yan Shi and
Junsuo Qu},
title = {Adaptive Fixed-Time Fuzzy Control for Uncertain Nonlinear Systems
with Asymmetric Time-Varying Full-State Constraints},
journal = {Int. J. Fuzzy Syst.},
volume = {25},
number = {4},
pages = {1597--1611},
year = {2023},
url = {https://doi.org/10.1007/s40815-023-01461-w},
doi = {10.1007/S40815-023-01461-W},
timestamp = {Thu, 01 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijfs/LiuLSQ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijns/XuWYZLZGJZWWFYZ23,
author = {Fangzhou Xu and
Chongfeng Wang and
Xin Yu and
Jinzhao Zhao and
Ming Liu and
Jiaqi Zhao and
Licai Gao and
Xiuquan Jiang and
Zhaoxin Zhu and
Yongjian Wu and
Dezheng Wang and
Shanxin Feng and
Sen Yin and
Yang Zhang and
Jiancai Leng},
title = {One-Dimensional Local Binary Pattern and Common Spatial Pattern Feature
Fusion Brain Network for Central Neuropathic Pain},
journal = {Int. J. Neural Syst.},
volume = {33},
number = {6},
pages = {2350030:1--2350030:17},
year = {2023},
url = {https://doi.org/10.1142/S0129065723500302},
doi = {10.1142/S0129065723500302},
timestamp = {Thu, 29 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijns/XuWYZLZGJZWWFYZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/YiDLHKZ23,
author = {Weichao Yi and
Liquan Dong and
Ming Liu and
Mei Hui and
Lingqin Kong and
Yuejin Zhao},
title = {Semi-supervised progressive dehazing network using unlabeled contrastive
guidance},
journal = {Neurocomputing},
volume = {551},
pages = {126494},
year = {2023},
url = {https://doi.org/10.1016/j.neucom.2023.126494},
doi = {10.1016/J.NEUCOM.2023.126494},
timestamp = {Wed, 09 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/YiDLHKZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/information/RenWMZL23,
author = {Binbin Ren and
Zhaoyuxuan Wang and
Kainan Ma and
Yiheng Zhou and
Ming Liu},
title = {An Improved Method of Heart Rate Extraction Algorithm Based on Photoplethysmography
for Sports Bracelet},
journal = {Inf.},
volume = {14},
number = {5},
pages = {297},
year = {2023},
url = {https://doi.org/10.3390/info14050297},
doi = {10.3390/INFO14050297},
timestamp = {Thu, 15 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/information/RenWMZL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/WangLMFZJWY23,
author = {Yilei Wang and
Ming Liu and
Huawei Ma and
Shuyu Fan and
Huiyu Zhou and
Siqi Ju and
Xiaoying Wang and
Qintai Yang},
title = {Enabling scalable and unlinkable payment channel hubs with oblivious
puzzle transfer},
journal = {Inf. Sci.},
volume = {630},
pages = {713--726},
year = {2023},
url = {https://doi.org/10.1016/j.ins.2023.02.024},
doi = {10.1016/J.INS.2023.02.024},
timestamp = {Tue, 28 Mar 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/isci/WangLMFZJWY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/itl/ChangWLL23,
author = {Ying Chang and
Lan Wang and
Lingjie Lin and
Ming Liu},
title = {A unified auto-encoder method for gait recognition under different
sensor locations},
journal = {Internet Technol. Lett.},
volume = {6},
number = {5},
year = {2023},
url = {https://doi.org/10.1002/itl2.379},
doi = {10.1002/ITL2.379},
timestamp = {Sat, 14 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/itl/ChangWLL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jaihc/0001ZLXW23,
author = {Shuaiqi Liu and
Chuanqing Zhao and
Ming Liu and
Qi Xin and
Shui{-}Hua Wang},
title = {Diffusion tensor imaging denoising based on Riemann nonlocal similarity},
journal = {J. Ambient Intell. Humaniz. Comput.},
volume = {14},
number = {5},
pages = {5369--5382},
year = {2023},
url = {https://doi.org/10.1007/s12652-019-01642-2},
doi = {10.1007/S12652-019-01642-2},
timestamp = {Thu, 01 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jaihc/0001ZLXW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocn/HuangPLZ23,
author = {Yingying Huang and
Frank E. Pollick and
Ming Liu and
Delong Zhang},
title = {Gabor and Non-Gabor Neural Representations Are Shared between Visual
Perception and Mental Imagery},
journal = {J. Cogn. Neurosci.},
volume = {35},
number = {6},
pages = {1045--1060},
year = {2023},
url = {https://doi.org/10.1162/jocn\_a\_01992},
doi = {10.1162/JOCN\_A\_01992},
timestamp = {Thu, 15 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jocn/HuangPLZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/JiangZCXLLMC23,
author = {Wenning Jiang and
Yan Zhu and
Chixiao Chen and
Hao Xu and
Qi Liu and
Ming Liu and
Rui Paulo Martins and
Chi{-}Hang Chan},
title = {A 14b 500 MS/s Single-Channel Pipelined-SAR {ADC} With Reference Ripple
Mitigation Techniques and Adaptively Biased Floating Inverter Amplifier},
journal = {{IEEE} J. Solid State Circuits},
volume = {58},
number = {10},
pages = {2709--2721},
year = {2023},
url = {https://doi.org/10.1109/JSSC.2023.3290119},
doi = {10.1109/JSSC.2023.3290119},
timestamp = {Sat, 14 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/JiangZCXLLMC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/YeWZALGLYHXYLSZTDLL23,
author = {Wang Ye and
Linfang Wang and
Zhidao Zhou and
Junjie An and
Weizeng Li and
Hanghang Gao and
Zhi Li and
Jinshan Yue and
Hongyang Hu and
Xiaoxin Xu and
Jianguo Yang and
Jing Liu and
Dashan Shang and
Feng Zhang and
Jinghui Tian and
Chunmeng Dou and
Qi Liu and
Ming Liu},
title = {A 28-nm {RRAM} Computing-in-Memory Macro Using Weighted Hybrid 2T1R
Cell Array and Reference Subtracting Sense Amplifier for {AI} Edge
Inference},
journal = {{IEEE} J. Solid State Circuits},
volume = {58},
number = {10},
pages = {2839--2850},
year = {2023},
url = {https://doi.org/10.1109/JSSC.2023.3280357},
doi = {10.1109/JSSC.2023.3280357},
timestamp = {Sat, 28 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/YeWZALGLYHXYLSZTDLL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/natmi/WangLWZCDWZLGXLCWSL23,
author = {Shaocong Wang and
Yi Li and
Dingchen Wang and
Woyu Zhang and
Xi Chen and
Danian Dong and
Songqi Wang and
Xumeng Zhang and
Peng Lin and
Claudio Gallicchio and
Xiaoxin Xu and
Qi Liu and
Kwang{-}Ting Cheng and
Zhongrui Wang and
Dashan Shang and
Ming Liu},
title = {Echo state graph neural networks with analogue random resistive memory
arrays},
journal = {Nat. Mac. Intell.},
volume = {5},
number = {2},
pages = {104--113},
year = {2023},
url = {https://doi.org/10.1038/s42256-023-00609-5},
doi = {10.1038/S42256-023-00609-5},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/natmi/WangLWZCDWZLGXLCWSL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/LiLTW23,
author = {Run Li and
Ming Liu and
Johannes Teutsch and
Dirk Wollherr},
title = {Constraint trajectory planning for redundant space robot},
journal = {Neural Comput. Appl.},
volume = {35},
number = {34},
pages = {24243--24258},
year = {2023},
url = {https://doi.org/10.1007/s00521-023-08972-5},
doi = {10.1007/S00521-023-08972-5},
timestamp = {Mon, 13 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nca/LiLTW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/GuLLHW23,
author = {Changjun Gu and
Suju Li and
Ming Liu and
Kailong Hu and
Ping Wang},
title = {Monitoring Glacier Lake Outburst Flood {(GLOF)} of Lake Merzbacher
Using Dense Chinese High-Resolution Satellite Images},
journal = {Remote. Sens.},
volume = {15},
number = {7},
pages = {1941},
year = {2023},
url = {https://doi.org/10.3390/rs15071941},
doi = {10.3390/RS15071941},
timestamp = {Sun, 16 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/GuLLHW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/TianHLLZL23,
author = {Di Tian and
Yi Han and
Yongtao Liu and
Jiabo Li and
Ping Zhang and
Ming Liu},
title = {Hybrid Cross-Feature Interaction Attention Module for Object Detection
in Intelligent Mobile Scenes},
journal = {Remote. Sens.},
volume = {15},
number = {20},
pages = {4991},
year = {2023},
url = {https://doi.org/10.3390/rs15204991},
doi = {10.3390/RS15204991},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/remotesensing/TianHLLZL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/OuyangLCYHZ23,
author = {Yewei Ouyang and
Ming Liu and
Cheng Cheng and
Yuchen Yang and
Shiyi He and
Lan Zheng},
title = {Monitoring Inattention in Construction Workers Caused by Physical
Fatigue Using Electrocardiograph {(ECG)} and Galvanic Skin Response
{(GSR)} Sensors},
journal = {Sensors},
volume = {23},
number = {17},
pages = {7405},
year = {2023},
url = {https://doi.org/10.3390/s23177405},
doi = {10.3390/S23177405},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/OuyangLCYHZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/soco/LiuZXC23,
author = {Ming Liu and
Hua Zhao and
Zeshui Xu and
Feng Cui},
title = {A novel projection-based distance measure for interval-valued intuitionistic
multiplicative clustering algorithm},
journal = {Soft Comput.},
volume = {27},
number = {5},
pages = {2369--2383},
year = {2023},
url = {https://doi.org/10.1007/s00500-022-07765-7},
doi = {10.1007/S00500-022-07765-7},
timestamp = {Mon, 27 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/soco/LiuZXC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/ZhangLXDYXHL23,
author = {Jieshuo Zhang and
Ming Liu and
Peng Xiong and
Haiman Du and
Jianli Yang and
Jinpeng Xu and
Zengguang Hou and
Xiuling Liu},
title = {Automated Localization of Myocardial Infarction From Vectorcardiographic
via Tensor Decomposition},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {70},
number = {3},
pages = {812--823},
year = {2023},
url = {https://doi.org/10.1109/TBME.2022.3202962},
doi = {10.1109/TBME.2022.3202962},
timestamp = {Sat, 11 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbe/ZhangLXDYXHL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcbb/LiWYL23,
author = {Jianwei Li and
Duanyang Wang and
Zhenwu Yang and
Ming Liu},
title = {{HEGANLDA:} {A} Computational Model for Predicting Potential Lncrna-Disease
Associations Based On Multiple Heterogeneous Networks},
journal = {{IEEE} {ACM} Trans. Comput. Biol. Bioinform.},
volume = {20},
number = {1},
pages = {388--398},
year = {2023},
url = {https://doi.org/10.1109/TCBB.2021.3136886},
doi = {10.1109/TCBB.2021.3136886},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcbb/LiWYL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcbb/PengLDCFP23,
author = {Wei Peng and
Ming Liu and
Wei Dai and
Tielin Chen and
Yu Fu and
Yi Pan},
title = {Multi-View Feature Aggregation for Predicting Microbe-Disease Association},
journal = {{IEEE} {ACM} Trans. Comput. Biol. Bioinform.},
volume = {20},
number = {5},
pages = {2748--2758},
year = {2023},
url = {https://doi.org/10.1109/TCBB.2021.3132611},
doi = {10.1109/TCBB.2021.3132611},
timestamp = {Fri, 27 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcbb/PengLDCFP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/RenHLLLL23,
author = {Minjie Ren and
Xiangdong Huang and
Jing Liu and
Ming Liu and
Xuanya Li and
An{-}An Liu},
title = {{MALN:} Multimodal Adversarial Learning Network for Conversational
Emotion Recognition},
journal = {{IEEE} Trans. Circuits Syst. Video Technol.},
volume = {33},
number = {11},
pages = {6965--6980},
year = {2023},
url = {https://doi.org/10.1109/TCSVT.2023.3273577},
doi = {10.1109/TCSVT.2023.3273577},
timestamp = {Mon, 13 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcsv/RenHLLLL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/LiHLGHWL23,
author = {Liangzhi Li and
Ling Han and
Ming Liu and
Kyle Gao and
Hongjie He and
Lanying Wang and
Jonathan Li},
title = {SAR-Optical Image Matching With Semantic Position Probability Distribution},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {61},
pages = {1--15},
year = {2023},
url = {https://doi.org/10.1109/TGRS.2023.3330856},
doi = {10.1109/TGRS.2023.3330856},
timestamp = {Sun, 10 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgrs/LiHLGHWL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/LiuGXZSZWZHJL23,
author = {Jiaming Liu and
Mengmeng Guan and
Yiwei Xu and
Shuang Zhao and
Wei Su and
Cuiling Zhang and
Zhiguang Wang and
Xiaohui Zhang and
Zhongqiang Hu and
Zhuangde Jiang and
Ming Liu},
title = {Enhanced Limit-of-Detection of Current Sensor Based on Tunneling Magnetoresistive
Effect With Multichips Differential Design},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {72},
pages = {1--9},
year = {2023},
url = {https://doi.org/10.1109/TIM.2023.3322494},
doi = {10.1109/TIM.2023.3322494},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tim/LiuGXZSZWZHJL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/LyuWLBLY23,
author = {Pin Lyu and
Bingqing Wang and
Jizhou Lai and
Shiyu Bai and
Ming Liu and
Wenbin Yu},
title = {A Factor Graph Optimization Method for High-Precision IMU-Based Navigation
System},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {72},
pages = {1--12},
year = {2023},
url = {https://doi.org/10.1109/TIM.2023.3291779},
doi = {10.1109/TIM.2023.3291779},
timestamp = {Sat, 05 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tim/LyuWLBLY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/WeiFLSPHQ23,
author = {Debao Wei and
Hua Feng and
Ming Liu and
Yu Song and
Zhelong Piao and
Cong Hu and
Liyan Qiao},
title = {Edge Word-Line Reliability Problem in 3-D {NAND} Flash Memory: Observations,
Analysis, and Solutions},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {31},
number = {6},
pages = {861--873},
year = {2023},
url = {https://doi.org/10.1109/TVLSI.2023.3249183},
doi = {10.1109/TVLSI.2023.3249183},
timestamp = {Fri, 02 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvlsi/WeiFLSPHQ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/ChenHXFLSYQ23,
author = {Huajie Chen and
Jiyuan He and
Weisheng Xu and
Tao Feng and
Ming Liu and
Tianyu Song and
Runfeng Yao and
Yuanyuan Qiao},
editor = {Brian Williams and
Yiling Chen and
Jennifer Neville},
title = {Enhanced Multi-Relationships Integration Graph Convolutional Network
for Inferring Substitutable and Complementary Items},
booktitle = {Thirty-Seventh {AAAI} Conference on Artificial Intelligence, {AAAI}
2023, Thirty-Fifth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2023, Thirteenth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2023, Washington, DC, USA, February
7-14, 2023},
pages = {4157--4165},
publisher = {{AAAI} Press},
year = {2023},
url = {https://doi.org/10.1609/aaai.v37i4.25532},
doi = {10.1609/AAAI.V37I4.25532},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/ChenHXFLSYQ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl-clinicalnlp/LiuBCAS23,
author = {Ming Liu and
Richard Beare and
Taya Collyer and
Nadine Andrew and
Velandai Srikanth},
editor = {Tristan Naumann and
Asma Ben Abacha and
Steven Bethard and
Kirk Roberts and
Anna Rumshisky},
title = {Leveraging Natural Language Processing and Clinical Notes for Dementia
Detection},
booktitle = {Proceedings of the 5th Clinical Natural Language Processing Workshop,
ClinicalNLP@ACL 2023, Toronto, Canada, July 14, 2023},
pages = {150--155},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.clinicalnlp-1.20},
doi = {10.18653/V1/2023.CLINICALNLP-1.20},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl-clinicalnlp/LiuBCAS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asru/ZhangZHZLX23,
author = {Ao Zhang and
Pan Zhou and
Kaixun Huang and
Yong Zou and
Ming Liu and
Lei Xie},
title = {{U2-KWS:} Unified Two-Pass Open-Vocabulary Keyword Spotting with Keyword
Bias},
booktitle = {{IEEE} Automatic Speech Recognition and Understanding Workshop, {ASRU}
2023, Taipei, Taiwan, December 16-20, 2023},
pages = {1--8},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ASRU57964.2023.10389755},
doi = {10.1109/ASRU57964.2023.10389755},
timestamp = {Tue, 13 Feb 2024 21:21:14 +0100},
biburl = {https://dblp.org/rec/conf/asru/ZhangZHZLX23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibm/LiuLXZWH23,
author = {Ming Liu and
Ziji Liu and
Liang Xiao and
Rujun Zhu and
Qianchen Wang and
Miaomiao He},
editor = {Xingpeng Jiang and
Haiying Wang and
Reda Alhajj and
Xiaohua Hu and
Felix Engel and
Mufti Mahmud and
Nadia Pisanti and
Xuefeng Cui and
Hong Song},
title = {A Study of Medical Decision Recommendation Generation and Similarity
Fusion Based on {CDSS} and ChatGPT-4},
booktitle = {{IEEE} International Conference on Bioinformatics and Biomedicine,
{BIBM} 2023, Istanbul, Turkiye, December 5-8, 2023},
pages = {873--878},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/BIBM58861.2023.10385915},
doi = {10.1109/BIBM58861.2023.10385915},
timestamp = {Sat, 20 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bibm/LiuLXZWH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bionlp/LiuZTZ23,
author = {Ming Liu and
Dan Zhang and
Weicong Tan and
He Zhang},
editor = {Dina Demner{-}Fushman and
Sophia Ananiadou and
Kevin Cohen},
title = {DeakinNLP at ProbSum 2023: Clinical Progress Note Summarization with
Rules and Language ModelsClinical Progress Note Summarization with
Rules and Languague Models},
booktitle = {The 22nd Workshop on Biomedical Natural Language Processing and BioNLP
Shared Tasks, BioNLP@ACL 2023, Toronto, Canada, 13 July 2023},
pages = {491--496},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.bionlp-1.47},
doi = {10.18653/V1/2023.BIONLP-1.47},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bionlp/LiuZTZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/WangSHLXFL23,
author = {Zihong Wang and
Yingxia Shao and
Jiyuan He and
Jinbao Liu and
Shitao Xiao and
Tao Feng and
Ming Liu},
editor = {Ingo Frommholz and
Frank Hopfgartner and
Mark Lee and
Michael Oakes and
Mounia Lalmas and
Min Zhang and
Rodrygo L. T. Santos},
title = {Diversity-aware Deep Ranking Network for Recommendation},
booktitle = {Proceedings of the 32nd {ACM} International Conference on Information
and Knowledge Management, {CIKM} 2023, Birmingham, United Kingdom,
October 21-25, 2023},
pages = {2564--2573},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3583780.3614848},
doi = {10.1145/3583780.3614848},
timestamp = {Fri, 27 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cikm/WangSHLXFL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cisc/LiuZLHLWL23,
author = {Ming Liu and
Mingyue Zhang and
Guangshun Li and
Yuemei Hu and
Tao Li and
Yilei Wang and
Bo Lan},
editor = {Chunpeng Ge and
Moti Yung},
title = {Epoch: Enabling Path Concealing Payment Channel Hubs with Optimal
Path Encryption},
booktitle = {Information Security and Cryptology - 19th International Conference,
Inscrypt 2023, Hangzhou, China, December 9-10, 2023, Revised Selected
Papers, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {14526},
pages = {107--125},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-981-97-0942-7\_6},
doi = {10.1007/978-981-97-0942-7\_6},
timestamp = {Mon, 11 Mar 2024 15:20:47 +0100},
biburl = {https://dblp.org/rec/conf/cisc/LiuZLHLWL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cpsweek/XuanLNZX023,
author = {Ziyi Xuan and
Ming Liu and
Jingping Nie and
Minghui Zhao and
Stephen Xia and
Xiaofan Jiang},
title = {CaNRun: Non-Contact, Acoustic-based Cadence Estimation on Treadmills
using Smartphones},
booktitle = {Proceedings of Cyber-Physical Systems and Internet of Things Week
2023, CPS-IoT Week 2023 Workshops, San Antonio, TX, USA, May 9-12,
2023},
pages = {272--277},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3576914.3589561},
doi = {10.1145/3576914.3589561},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cpsweek/XuanLNZX023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/CaoLLWLZ23,
author = {Yue Cao and
Ming Liu and
Shuai Liu and
Xiaotao Wang and
Lei Lei and
Wangmeng Zuo},
title = {Physics-Guided ISO-Dependent Sensor Noise Modeling for Extreme Low-Light
Photography},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023, Vancouver, BC, Canada, June 17-24, 2023},
pages = {5744--5753},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPR52729.2023.00556},
doi = {10.1109/CVPR52729.2023.00556},
timestamp = {Mon, 28 Aug 2023 16:14:07 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/CaoLLWLZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ChenLZLZZ23,
author = {Du Chen and
Jie Liang and
Xindong Zhang and
Ming Liu and
Hui Zeng and
Lei Zhang},
title = {Human Guided Ground-Truth Generation for Realistic Image Super-Resolution},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023, Vancouver, BC, Canada, June 17-24, 2023},
pages = {14082--14091},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPR52729.2023.01353},
doi = {10.1109/CVPR52729.2023.01353},
timestamp = {Tue, 29 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/ChenLZLZZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/Guo0LJBGZ23,
author = {Zixian Guo and
Yuxiang Wei and
Ming Liu and
Zhilong Ji and
Jinfeng Bai and
Yiwen Guo and
Wangmeng Zuo},
editor = {Houda Bouamor and
Juan Pino and
Kalika Bali},
title = {Black-Box Tuning of Vision-Language Models with Effective Gradient
Approximation},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2023, Singapore, December 6-10, 2023},
pages = {5356--5368},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.findings-emnlp.356},
doi = {10.18653/V1/2023.FINDINGS-EMNLP.356},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/Guo0LJBGZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fedcsis/RutaLC23,
author = {Dymitr Ruta and
Ming Liu and
Ling Cen},
editor = {Maria Ganzha and
Leszek A. Maciaszek and
Marcin Paprzycki and
Dominik Slezak},
title = {Beating Gradient Boosting: Target-Guided Binning for Massively Scalable
Classification in Real-Time},
booktitle = {Proceedings of the 18th Conference on Computer Science and Intelligence
Systems, FedCSIS 2023, Warsaw, Poland, September 17-20, 2023},
series = {Annals of Computer Science and Information Systems},
volume = {35},
pages = {1301--1306},
year = {2023},
url = {https://doi.org/10.15439/2023F7166},
doi = {10.15439/2023F7166},
timestamp = {Tue, 23 Apr 2024 09:40:36 +0200},
biburl = {https://dblp.org/rec/conf/fedcsis/RutaLC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fedcsis/LiuCR23,
author = {Ming Liu and
Ling Cen and
Dymitr Ruta},
editor = {Maria Ganzha and
Leszek A. Maciaszek and
Marcin Paprzycki and
Dominik Slezak},
title = {Gradient boosting models for cybersecurity threat detection with aggregated
time series features},
booktitle = {Proceedings of the 18th Conference on Computer Science and Intelligence
Systems, FedCSIS 2023, Warsaw, Poland, September 17-20, 2023},
series = {Annals of Computer Science and Information Systems},
volume = {35},
pages = {1311--1315},
year = {2023},
url = {https://doi.org/10.15439/2023F4457},
doi = {10.15439/2023F4457},
timestamp = {Wed, 18 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fedcsis/LiuCR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/haptics/DriscollLH23,
author = {Brendan Driscoll and
Ming Liu and
He Huang},
title = {1-D Manual Tracing Based on a High Density Haptic Stimulation Grid
- a Pilot Effort},
booktitle = {{IEEE} World Haptics Conference, {WHC} 2023, Delft, Netherlands, July
10-13, 2023},
pages = {375--381},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/WHC56415.2023.10224505},
doi = {10.1109/WHC56415.2023.10224505},
timestamp = {Mon, 08 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/haptics/DriscollLH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ica3pp/DuanCJL23,
author = {Yali Duan and
Jianming Cui and
Yungang Jia and
Ming Liu},
editor = {Zahir Tari and
Keqiu Li and
Hongyi Wu},
title = {Intrusion Detection Method for Networked Vehicles Based on Data-Enhanced
{DBN}},
booktitle = {Algorithms and Architectures for Parallel Processing - 23rd International
Conference, {ICA3PP} 2023, Tianjin, China, October 20-22, 2023, Proceedings,
Part {II}},
series = {Lecture Notes in Computer Science},
volume = {14488},
pages = {40--52},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-981-97-0801-7\_3},
doi = {10.1007/978-981-97-0801-7\_3},
timestamp = {Mon, 11 Mar 2024 15:20:45 +0100},
biburl = {https://dblp.org/rec/conf/ica3pp/DuanCJL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ica3pp/ZhaoCL23,
author = {Yixuan Zhao and
Jianming Cui and
Ming Liu},
editor = {Zahir Tari and
Keqiu Li and
Hongyi Wu},
title = {A Hybrid Few-Shot Learning Based Intrusion Detection Method for Internet
of Vehicles},
booktitle = {Algorithms and Architectures for Parallel Processing - 23rd International
Conference, {ICA3PP} 2023, Tianjin, China, October 20-22, 2023, Proceedings,
Part {II}},
series = {Lecture Notes in Computer Science},
volume = {14488},
pages = {207--220},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-981-97-0801-7\_12},
doi = {10.1007/978-981-97-0801-7\_12},
timestamp = {Mon, 11 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ica3pp/ZhaoCL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ica3pp/LiuJLFZ23,
author = {Ming Liu and
Yungang Jia and
Chao Li and
Peiguo Fu and
Zhen Zhang},
editor = {Zahir Tari and
Keqiu Li and
Hongyi Wu},
title = {Multi-agent Cooperative Intrusion Detection Based on Generative Data
Augmentation},
booktitle = {Algorithms and Architectures for Parallel Processing - 23rd International
Conference, {ICA3PP} 2023, Tianjin, China, October 20-22, 2023, Proceedings,
Part {VI}},
series = {Lecture Notes in Computer Science},
volume = {14492},
pages = {311--328},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-981-97-0811-6\_19},
doi = {10.1007/978-981-97-0811-6\_19},
timestamp = {Mon, 11 Mar 2024 15:20:46 +0100},
biburl = {https://dblp.org/rec/conf/ica3pp/LiuJLFZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ica3pp/FuHLZJ23,
author = {Peiguo Fu and
ZhiTao Huang and
Ming Liu and
Zhiyun Zhao and
Wen Jiang},
editor = {Zahir Tari and
Keqiu Li and
Hongyi Wu},
title = {Research on the Evolution Path of Network Hotspot Events Based on
the Event Evolutionary Graph},
booktitle = {Algorithms and Architectures for Parallel Processing - 23rd International
Conference, {ICA3PP} 2023, Tianjin, China, October 20-22, 2023, Proceedings,
Part {VI}},
series = {Lecture Notes in Computer Science},
volume = {14492},
pages = {368--381},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-981-97-0811-6\_22},
doi = {10.1007/978-981-97-0811-6\_22},
timestamp = {Mon, 11 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ica3pp/FuHLZJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/Cheng0L23,
author = {Jie Cheng and
Xiaodong Mei and
Ming Liu},
title = {Forecast-MAE: Self-supervised Pre-training for Motion Forecasting
with Masked Autoencoders},
booktitle = {{IEEE/CVF} International Conference on Computer Vision, {ICCV} 2023,
Paris, France, October 1-6, 2023},
pages = {8645--8655},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCV51070.2023.00797},
doi = {10.1109/ICCV51070.2023.00797},
timestamp = {Mon, 22 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccv/Cheng0L23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/LiuLLLWLZ23,
author = {Xiaoyu Liu and
Ming Liu and
Junyi Li and
Shuai Liu and
Xiaotao Wang and
Lei Lei and
Wangmeng Zuo},
title = {Beyond Image Borders: Learning Feature Extrapolation for Unbounded
Image Composition},
booktitle = {{IEEE/CVF} International Conference on Computer Vision, {ICCV} 2023,
Paris, France, October 1-6, 2023},
pages = {12977--12986},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCV51070.2023.01197},
doi = {10.1109/ICCV51070.2023.01197},
timestamp = {Mon, 22 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccv/LiuLLLWLZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/YinLLYXZ23,
author = {Zhicun Yin and
Ming Liu and
Xiaoming Li and
Hui Yang and
Longan Xiao and
Wangmeng Zuo},
title = {MetaF2N: Blind Image Super-Resolution by Learning Efficient Model
Adaptation from Faces},
booktitle = {{IEEE/CVF} International Conference on Computer Vision, {ICCV} 2023,
Paris, France, October 1-6, 2023},
pages = {12987--12998},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCV51070.2023.01198},
doi = {10.1109/ICCV51070.2023.01198},
timestamp = {Mon, 22 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccv/YinLLYXZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmcs/RutaLCW23,
author = {Dymitr Ruta and
Ming Liu and
Ling Cen and
Di Wang},
title = {Feature Engineering for Predicting Frags in Tactical Games},
booktitle = {{IEEE} International Conference on Multimedia and Expo Workshops,
{ICMEW} Workshops 2023, Brisbane, Australia, July 10-14, 2023},
pages = {28--33},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICMEW59549.2023.00011},
doi = {10.1109/ICMEW59549.2023.00011},
timestamp = {Fri, 19 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmcs/RutaLCW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iconip/WangLZS023,
author = {Jian Wang and
Ming Liu and
Danfeng Zhao and
Shuai Shi and
Wei Song},
editor = {Biao Luo and
Long Cheng and
Zheng{-}Guang Wu and
Hongyi Li and
Chaojie Li},
title = {Few-Shot {NER} in Marine Ecology Using Deep Learning},
booktitle = {Neural Information Processing - 30th International Conference, {ICONIP}
2023, Changsha, China, November 20-23, 2023, Proceedings, Part {XI}},
series = {Communications in Computer and Information Science},
volume = {1965},
pages = {15--26},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-981-99-8145-8\_2},
doi = {10.1007/978-981-99-8145-8\_2},
timestamp = {Mon, 27 Nov 2023 17:45:48 +0100},
biburl = {https://dblp.org/rec/conf/iconip/WangLZS023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/LiSLLM23,
author = {Shuang Li and
Yaoxia Shao and
Ming Liu and
Chang Liu and
Chengbin Ma},
title = {An Equivalent Parasitic Capacitor Based Modeling of Coils for MHz
Wireless Power Transfer Systems},
booktitle = {49th Annual Conference of the {IEEE} Industrial Electronics Society,
{IECON} 2023, Singapore, October 16-19, 2023},
pages = {1--6},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IECON51785.2023.10312406},
doi = {10.1109/IECON51785.2023.10312406},
timestamp = {Sat, 25 Nov 2023 16:52:31 +0100},
biburl = {https://dblp.org/rec/conf/iecon/LiSLLM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/ZhuLL23,
author = {Yongzhi Zhu and
Wei Liu and
Ming Liu},
title = {Explicit Design and Analysis of Inductive Clamping Class {E} Inverters
for {ZVS} Operation with Capacitive Load Impedance},
booktitle = {49th Annual Conference of the {IEEE} Industrial Electronics Society,
{IECON} 2023, Singapore, October 16-19, 2023},
pages = {1--6},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IECON51785.2023.10312637},
doi = {10.1109/IECON51785.2023.10312637},
timestamp = {Sat, 25 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iecon/ZhuLL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/LiuLZWLH23,
author = {Ming Liu and
Ziyan Liu and
Gaoxiang Zhou and
Ying Wang and
Xuanchen Liu and
Ling Han},
title = {Spatiotemporal Disparity and Environmental Inequality in Fossil Fuel
Carbon Emissions in China: 2010-2019},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2023, Pasadena, CA, USA, July 16-21, 2023},
pages = {2099--2102},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IGARSS52108.2023.10282947},
doi = {10.1109/IGARSS52108.2023.10282947},
timestamp = {Tue, 07 Nov 2023 16:21:25 +0100},
biburl = {https://dblp.org/rec/conf/igarss/LiuLZWLH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/MaPLW23,
author = {Xianping Ma and
Man{-}On Pun and
Ming Liu and
Yang Wang},
title = {Machine Learning-Based Approach For Landslide Susceptibility Mapping
Using Multimodal Data},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2023, Pasadena, CA, USA, July 16-21, 2023},
pages = {5174--5177},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IGARSS52108.2023.10282031},
doi = {10.1109/IGARSS52108.2023.10282031},
timestamp = {Tue, 07 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/MaPLW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/XiuMPL23,
author = {Xiaochen Xiu and
Xianping Ma and
Man{-}On Pun and
Ming Liu},
title = {MDAFNet: Monocular Depth-Assisted Fusion Networks for Semantic Segmentation
of Complex Urban Remote Sensing Data},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2023, Pasadena, CA, USA, July 16-21, 2023},
pages = {6847--6850},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IGARSS52108.2023.10282438},
doi = {10.1109/IGARSS52108.2023.10282438},
timestamp = {Tue, 07 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/XiuMPL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/LiLGB23,
author = {Xinzhe Li and
Ming Liu and
Shang Gao and
Wray L. Buntine},
title = {A Survey on Out-of-Distribution Evaluation of Neural {NLP} Models},
booktitle = {Proceedings of the Thirty-Second International Joint Conference on
Artificial Intelligence, {IJCAI} 2023, 19th-25th August 2023, Macao,
SAR, China},
pages = {6683--6691},
publisher = {ijcai.org},
year = {2023},
url = {https://doi.org/10.24963/ijcai.2023/749},
doi = {10.24963/IJCAI.2023/749},
timestamp = {Mon, 28 Aug 2023 17:23:07 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/LiLGB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/MaLWWQL23,
author = {Fulong Ma and
Yang Liu and
Sheng Wang and
Jin Wu and
Weiqing Qi and
Ming Liu},
title = {Self-Supervised Drivable Area Segmentation Using LiDAR's Depth Information
for Autonomous Driving},
booktitle = {{IROS}},
pages = {41--48},
year = {2023},
url = {https://doi.org/10.1109/IROS55552.2023.10341687},
doi = {10.1109/IROS55552.2023.10341687},
timestamp = {Fri, 05 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iros/MaLWWQL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isaims/LiuHJLT23,
author = {Ming Liu and
Lili Huang and
Bo Jiang and
Chuanfu Li and
Jin Tang},
title = {Chest X-ray Image Quality Control via Transformer and Label Correlation
Regularization Loss},
booktitle = {Proceedings of the 2023 4th International Symposium on Artificial
Intelligence for Medicine Science, {ISAIMS} 2023, Chengdu, China,
October 20-22, 2023},
pages = {258--264},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3644116.3644162},
doi = {10.1145/3644116.3644162},
timestamp = {Tue, 16 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isaims/LiuHJLT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/LiuLZWZJTCLL23,
author = {Shiwei Liu and
Peizhe Li and
Jinshan Zhang and
Yunzhengmao Wang and
Haozhe Zhu and
Wenning Jiang and
Shan Tang and
Chixiao Chen and
Qi Liu and
Ming Liu},
title = {A 28nm 53.8TOPS/W 8b Sparse Transformer Accelerator with In-Memory
Butterfly Zero Skipper for Unstructured-Pruned {NN} and CIM-Based
Local-Attention-Reusable Engine},
booktitle = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2023,
San Francisco, CA, USA, February 19-23, 2023},
pages = {250--251},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ISSCC42615.2023.10067360},
doi = {10.1109/ISSCC42615.2023.10067360},
timestamp = {Wed, 05 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/LiuLZWZJTCLL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/issre/LiHFZL23,
author = {Ke Li and
Sheng Hong and
Cai Fu and
Yunhe Zhang and
Ming Liu},
title = {Discriminating Human-authored from ChatGPT-Generated Code Via Discernable
Feature Analysis},
booktitle = {34th {IEEE} International Symposium on Software Reliability Engineering,
{ISSRE} 2023 - Workshops, Florence, Italy, October 9-12, 2023},
pages = {120--127},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ISSREW60843.2023.00059},
doi = {10.1109/ISSREW60843.2023.00059},
timestamp = {Tue, 14 Nov 2023 16:09:48 +0100},
biburl = {https://dblp.org/rec/conf/issre/LiHFZL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itsc/PengZWZLM23,
author = {Zengqi Peng and
Xiao Zhou and
Yubin Wang and
Lei Zheng and
Ming Liu and
Jun Ma},
title = {Curriculum Proximal Policy Optimization with Stage-Decaying Clipping
for Self-Driving at Unsignalized Intersections},
booktitle = {25th {IEEE} International Conference on Intelligent Transportation
Systems, {ITSC} 2022, Macau, China, October 8-12, 2022},
pages = {5027--5033},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ITSC57777.2023.10422594},
doi = {10.1109/ITSC57777.2023.10422594},
timestamp = {Thu, 22 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/itsc/PengZWZLM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/XuWZZSLLTXC23,
author = {Jingcheng Xu and
Zhuoshi Wang and
Weifang Zhu and
Yi Zhou and
Yan Sun and
Zhuang Li and
Ming Liu and
Wenhao Tan and
Ling Xu and
Xinjian Chen},
editor = {Bhavna Josephine Antony and
Hao Chen and
Huihui Fang and
Huazhu Fu and
Cecilia S. Lee and
Yalin Zheng},
title = {UAU-Net: United Attention U-Shaped Network for the Segmentation of
Pigment Deposits in Fundus Images of Retinitis Pigmentosa},
booktitle = {Ophthalmic Medical Image Analysis - 10th International Workshop, {OMIA}
2023, Held in Conjunction with {MICCAI} 2023, Vancouver, BC, Canada,
October 12, 2023, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {14096},
pages = {52--61},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-44013-7\_6},
doi = {10.1007/978-3-031-44013-7\_6},
timestamp = {Tue, 19 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/miccai/XuWZZSLLTXC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nlpcc/LiuDGLLWS23,
author = {Yuting Liu and
Kun Ding and
Fengxiao Guo and
Ming Liu and
Liu Liu and
Baowei Wang and
Yi Sun},
editor = {Fei Liu and
Nan Duan and
Qingting Xu and
Yu Hong},
title = {Improving Event Representation for Script Event Prediction via Data
Augmentation and Integration},
booktitle = {Natural Language Processing and Chinese Computing - 12th National
{CCF} Conference, {NLPCC} 2023, Foshan, China, October 12-15, 2023,
Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {14303},
pages = {666--677},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-44696-2\_52},
doi = {10.1007/978-3-031-44696-2\_52},
timestamp = {Wed, 11 Oct 2023 18:49:12 +0200},
biburl = {https://dblp.org/rec/conf/nlpcc/LiuDGLLWS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ranlp/LiuP23,
author = {Ming Liu and
Massimo Poesio},
editor = {Ruslan Mitkov and
Galia Angelova},
title = {Data Augmentation for Fake Reviews Detection},
booktitle = {Proceedings of the 14th International Conference on Recent Advances
in Natural Language Processing, {RANLP} 2023, Varna, Bulgaria, 4-6
September 2023},
pages = {673--680},
publisher = {{INCOMA} Ltd., Shoumen, Bulgaria},
year = {2023},
url = {https://aclanthology.org/2023.ranlp-1.73},
timestamp = {Wed, 15 Nov 2023 13:49:17 +0100},
biburl = {https://dblp.org/rec/conf/ranlp/LiuP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/spml/XiaLSHLS23,
author = {Tongnan Xia and
Ming Liu and
Jie Sun and
Enruo Huang and
Shaolin Liang and
Yaojie Sun},
title = {The design of rotation-symmetric Gaussian low-pass filter {(RSGLPF)}
and its applications},
booktitle = {6th International Conference on Signal Processing and Machine Learning,
{SPML} 2023, Tianjin, China, July 14-16, 2023},
pages = {350--356},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3614008.3614060},
doi = {10.1145/3614008.3614060},
timestamp = {Thu, 19 Oct 2023 14:01:53 +0200},
biburl = {https://dblp.org/rec/conf/spml/XiaLSHLS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/srds/ZhangMCLSX23,
author = {Han Zhang and
Dengke Mi and
Libo Chen and
Ming Liu and
Yong Shi and
Zhi Xue},
title = {Subdomain Protection is Needed: An {SPF} and DMARC-Based Empirical
Measurement Study and Proactive Solution of Email Security},
booktitle = {42nd International Symposium on Reliable Distributed Systems, {SRDS}
2023, Marrakesh, Morocco, September 25-29, 2023},
pages = {140--150},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/SRDS60354.2023.00023},
doi = {10.1109/SRDS60354.2023.00023},
timestamp = {Mon, 19 Feb 2024 16:30:08 +0100},
biburl = {https://dblp.org/rec/conf/srds/ZhangMCLSX23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/starsem/LiLG23,
author = {Xinzhe Li and
Ming Liu and
Shang Gao},
editor = {Alexis Palmer and
Jos{\'{e}} Camacho{-}Collados},
title = {Can Pretrained Language Models Derive Correct Semantics from Corrupt
Subwords under Noise?},
booktitle = {Proceedings of the The 12th Joint Conference on Lexical and Computational
Semantics, *SEM@ACL 2023, Toronto, Canada, July 13-14, 2023},
pages = {165--173},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.starsem-1.15},
doi = {10.18653/V1/2023.STARSEM-1.15},
timestamp = {Thu, 05 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/starsem/LiLG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/DingYLGWJLCWWGX23,
author = {Yaxin Ding and
Jianguo Yang and
Yu Liu and
Jianfeng Gao and
Yuan Wang and
Pengfei Jiang and
Shuxian Lv and
Yuting Chen and
Boping Wang and
Wei Wei and
Tiancheng Gong and
Kanhao Xue and
Qing Luo and
Xiangshui Miao and
Ming Liu},
title = {16-layer 3D Vertical {RRAM} with Low Read Latency (18ns), High Nonlinearity
({\textgreater}5000) and Ultra-low Leakage Current ({\textasciitilde}pA)
Self-Selective Cells},
booktitle = {2023 {IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits), Kyoto, Japan, June 11-16, 2023},
pages = {1--2},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.23919/VLSITechnologyandCir57934.2023.10185341},
doi = {10.23919/VLSITECHNOLOGYANDCIR57934.2023.10185341},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/DingYLGWJLCWWGX23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/GongXWJYNHWYGLL23,
author = {Tiancheng Gong and
Lihua Xu and
Wei Wei and
Pengfei Jiang and
Peng Yuan and
Bowen Nie and
Yuanquan Huang and
Yuan Wang and
Yang Yang and
Jianfeng Gao and
Junfeng Li and
Jun Luo and
Lingfei Wang and
Jianguo Yang and
Qing Luo and
Ling Li and
Steve S. Chung and
Ming Liu},
title = {First Demonstration of a Design Methodology for Highly Reliable Operation
at High Temperature on 128kb 1T1C FeRAM Chip},
booktitle = {2023 {IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits), Kyoto, Japan, June 11-16, 2023},
pages = {1--2},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.23919/VLSITechnologyandCir57934.2023.10185402},
doi = {10.23919/VLSITECHNOLOGYANDCIR57934.2023.10185402},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/GongXWJYNHWYGLL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2301-04446,
author = {Mingkai Tang and
Boyi Liu and
Yuanhang Li and
Hongji Liu and
Ming Liu and
Lujia Wang},
title = {An Efficient Approach to the Online Multi-Agent Path Finding Problem
by Using Sustainable Information},
journal = {CoRR},
volume = {abs/2301.04446},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2301.04446},
doi = {10.48550/ARXIV.2301.04446},
eprinttype = {arXiv},
eprint = {2301.04446},
timestamp = {Wed, 26 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2301-04446.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2303-13069,
author = {Du Chen and
Jie Liang and
Xindong Zhang and
Ming Liu and
Hui Zeng and
Lei Zhang},
title = {Human Guided Ground-truth Generation for Realistic Image Super-resolution},
journal = {CoRR},
volume = {abs/2303.13069},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2303.13069},
doi = {10.48550/ARXIV.2303.13069},
eprinttype = {arXiv},
eprint = {2303.13069},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2303-13069.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-10719,
author = {Yuxuan Liu and
Zhenhua Xu and
Huaiyang Huang and
Lujia Wang and
Ming Liu},
title = {FSNet: Redesign Self-Supervised MonoDepth for Full-Scale Depth Prediction
for Autonomous Driving},
journal = {CoRR},
volume = {abs/2304.10719},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.10719},
doi = {10.48550/ARXIV.2304.10719},
eprinttype = {arXiv},
eprint = {2304.10719},
timestamp = {Tue, 02 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-10719.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-13953,
author = {Ming Liu},
title = {Automatic Localization and Detection Applicable to Robust Image Watermarking
Resisting against Camera Shooting},
journal = {CoRR},
volume = {abs/2304.13953},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.13953},
doi = {10.48550/ARXIV.2304.13953},
eprinttype = {arXiv},
eprint = {2304.13953},
timestamp = {Wed, 03 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-13953.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-14397,
author = {Ke Li and
Sheng Hong and
Cai Fu and
Yunhe Zhang and
Ming Liu},
title = {Deciphering the Code: Distinguishing ChatGPT-Generated Code from Human-authored
Code through Discriminative Feature Analysis and Dataset Optimization},
journal = {CoRR},
volume = {abs/2306.14397},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.14397},
doi = {10.48550/ARXIV.2306.14397},
eprinttype = {arXiv},
eprint = {2306.14397},
timestamp = {Tue, 27 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-14397.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-15261,
author = {Xinzhe Li and
Ming Liu and
Shang Gao and
Wray L. Buntine},
title = {A Survey on Out-of-Distribution Evaluation of Neural {NLP} Models},
journal = {CoRR},
volume = {abs/2306.15261},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.15261},
doi = {10.48550/ARXIV.2306.15261},
eprinttype = {arXiv},
eprint = {2306.15261},
timestamp = {Fri, 30 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-15261.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-15268,
author = {Xinzhe Li and
Ming Liu and
Shang Gao},
title = {Can Pretrained Language Models Derive Correct Semantics from Corrupt
Subwords under Noise?},
journal = {CoRR},
volume = {abs/2306.15268},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.15268},
doi = {10.48550/ARXIV.2306.15268},
eprinttype = {arXiv},
eprint = {2306.15268},
timestamp = {Fri, 30 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-15268.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-00456,
author = {Xinzhe Li and
Ming Liu and
Shang Gao},
title = {Make Text Unlearnable: Exploiting Effective Patterns to Protect Personal
Data},
journal = {CoRR},
volume = {abs/2307.00456},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2307.00456},
doi = {10.48550/ARXIV.2307.00456},
eprinttype = {arXiv},
eprint = {2307.00456},
timestamp = {Mon, 10 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2307-00456.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-00771,
author = {Ning Lin and
Shaocong Wang and
Yi Li and
Bo Wang and
Shuhui Shi and
Yangu He and
Woyu Zhang and
Yifei Yu and
Yue Zhang and
Xiaojuan Qi and
Xiaoming Chen and
Hao Jiang and
Xumeng Zhang and
Peng Lin and
Xiaoxin Xu and
Qi Liu and
Zhongrui Wang and
Dashan Shang and
Ming Liu},
title = {Resistive memory-based zero-shot liquid state machine for multimodal
event data learning},
journal = {CoRR},
volume = {abs/2307.00771},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2307.00771},
doi = {10.48550/ARXIV.2307.00771},
eprinttype = {arXiv},
eprint = {2307.00771},
timestamp = {Wed, 20 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2307-00771.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-10574,
author = {Can Jiang and
Xin Li and
Jia{-}Rui Lin and
Ming Liu and
Zhiliang Ma},
title = {Adaptive Control of Resource Flow to Optimize Construction Work and
Cash Flow via Online Deep Reinforcement Learning},
journal = {CoRR},
volume = {abs/2307.10574},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2307.10574},
doi = {10.48550/ARXIV.2307.10574},
eprinttype = {arXiv},
eprint = {2307.10574},
timestamp = {Wed, 26 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2307-10574.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-14009,
author = {Tianyu Liu and
Hao Zhao and
Yang Yu and
Guyue Zhou and
Ming Liu},
title = {Car-Studio: Learning Car Radiance Fields from Single-View and Endless
In-the-wild Images},
journal = {CoRR},
volume = {abs/2307.14009},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2307.14009},
doi = {10.48550/ARXIV.2307.14009},
eprinttype = {arXiv},
eprint = {2307.14009},
timestamp = {Wed, 02 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2307-14009.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-09882,
author = {Jie Cheng and
Xiaodong Mei and
Ming Liu},
title = {Forecast-MAE: Self-supervised Pre-training for Motion Forecasting
with Masked Autoencoders},
journal = {CoRR},
volume = {abs/2308.09882},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2308.09882},
doi = {10.48550/ARXIV.2308.09882},
eprinttype = {arXiv},
eprint = {2308.09882},
timestamp = {Fri, 25 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2308-09882.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-15547,
author = {Shilei Sun and
Ming Liu and
Zhongyi Fan and
Yuxue Liu and
Chengwei Lv and
Liquan Dong and
Lingqin Kong},
title = {Efficient Ray Sampling for Radiance Fields Reconstruction},
journal = {CoRR},
volume = {abs/2308.15547},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2308.15547},
doi = {10.48550/ARXIV.2308.15547},
eprinttype = {arXiv},
eprint = {2308.15547},
timestamp = {Mon, 04 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2308-15547.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-16445,
author = {Zengqi Peng and
Xiao Zhou and
Yubin Wang and
Lei Zheng and
Ming Liu and
Jun Ma},
title = {Curriculum Proximal Policy Optimization with Stage-Decaying Clipping
for Self-Driving at Unsignalized Intersections},
journal = {CoRR},
volume = {abs/2308.16445},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2308.16445},
doi = {10.48550/ARXIV.2308.16445},
eprinttype = {arXiv},
eprint = {2308.16445},
timestamp = {Mon, 04 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2308-16445.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2309-08113,
author = {Zhicun Yin and
Ming Liu and
Xiaoming Li and
Hui Yang and
Longan Xiao and
Wangmeng Zuo},
title = {MetaF2N: Blind Image Super-Resolution by Learning Efficient Model
Adaptation from Faces},
journal = {CoRR},
volume = {abs/2309.08113},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2309.08113},
doi = {10.48550/ARXIV.2309.08113},
eprinttype = {arXiv},
eprint = {2309.08113},
timestamp = {Fri, 22 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2309-08113.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2309-10443,
author = {Jie Cheng and
Yingbing Chen and
Xiaodong Mei and
Bowen Yang and
Bo Li and
Ming Liu},
title = {Rethinking Imitation-based Planner for Autonomous Driving},
journal = {CoRR},
volume = {abs/2309.10443},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2309.10443},
doi = {10.48550/ARXIV.2309.10443},
eprinttype = {arXiv},
eprint = {2309.10443},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2309-10443.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2309-12042,
author = {Xiaoyu Liu and
Ming Liu and
Junyi Li and
Shuai Liu and
Xiaotao Wang and
Lei Lei and
Wangmeng Zuo},
title = {Beyond Image Borders: Learning Feature Extrapolation for Unbounded
Image Composition},
journal = {CoRR},
volume = {abs/2309.12042},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2309.12042},
doi = {10.48550/ARXIV.2309.12042},
eprinttype = {arXiv},
eprint = {2309.12042},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2309-12042.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-03732,
author = {Stella Ho and
Ming Liu and
Shang Gao and
Longxiang Gao},
title = {Learning to Learn for Few-shot Continual Active Learning},
journal = {CoRR},
volume = {abs/2311.03732},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.03732},
doi = {10.48550/ARXIV.2311.03732},
eprinttype = {arXiv},
eprint = {2311.03732},
timestamp = {Tue, 14 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-03732.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-07164,
author = {Yi Li and
Songqi Wang and
Yaping Zhao and
Shaocong Wang and
Woyu Zhang and
Yangu He and
Ning Lin and
Binbin Cui and
Xi Chen and
Shiming Zhang and
Hao Jiang and
Peng Lin and
Xumeng Zhang and
Xiaojuan Qi and
Zhongrui Wang and
Xiaoxin Xu and
Dashan Shang and
Qi Liu and
Kwang{-}Ting Cheng and
Ming Liu},
title = {Pruning random resistive memory for optimizing analogue {AI}},
journal = {CoRR},
volume = {abs/2311.07164},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.07164},
doi = {10.48550/ARXIV.2311.07164},
eprinttype = {arXiv},
eprint = {2311.07164},
timestamp = {Wed, 20 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-07164.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-14922,
author = {Ge Sun and
Sheng Wang and
Yang Xiao and
Lei Zhu and
Ming Liu},
title = {{GBD-TS:} Goal-based Pedestrian Trajectory Prediction with Diffusion
using Tree Sampling Algorithm},
journal = {CoRR},
volume = {abs/2311.14922},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.14922},
doi = {10.48550/ARXIV.2311.14922},
eprinttype = {arXiv},
eprint = {2311.14922},
timestamp = {Thu, 30 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-14922.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-00663,
author = {Kangcheng Liu and
Yong{-}Jin Liu and
Kai Tang and
Ming Liu and
Baoquan Chen},
title = {Generalized Label-Efficient 3D Scene Parsing via Hierarchical Feature
Aligned Pre-Training and Region-Aware Fine-tuning},
journal = {CoRR},
volume = {abs/2312.00663},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.00663},
doi = {10.48550/ARXIV.2312.00663},
eprinttype = {arXiv},
eprint = {2312.00663},
timestamp = {Fri, 08 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-00663.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-09262,
author = {Shaocong Wang and
Yizhao Gao and
Yi Li and
Woyu Zhang and
Yifei Yu and
Bo Wang and
Ning Lin and
Hegan Chen and
Yue Zhang and
Yang Jiang and
Dingchen Wang and
Jia Chen and
Peng Dai and
Hao Jiang and
Peng Lin and
Xumeng Zhang and
Xiaojuan Qi and
Xiaoxin Xu and
Hayden K. H. So and
Zhongrui Wang and
Dashan Shang and
Qi Liu and
Kwang{-}Ting Cheng and
Ming Liu},
title = {Random resistive memory-based deep extreme point learning machine
for unified visual processing},
journal = {CoRR},
volume = {abs/2312.09262},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.09262},
doi = {10.48550/ARXIV.2312.09262},
eprinttype = {arXiv},
eprint = {2312.09262},
timestamp = {Wed, 20 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-09262.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-09760,
author = {Ao Zhang and
Pan Zhou and
Kaixun Huang and
Yong Zou and
Ming Liu and
Lei Xie},
title = {{U2-KWS:} Unified Two-pass Open-vocabulary Keyword Spotting with Keyword
Bias},
journal = {CoRR},
volume = {abs/2312.09760},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.09760},
doi = {10.48550/ARXIV.2312.09760},
eprinttype = {arXiv},
eprint = {2312.09760},
timestamp = {Tue, 13 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-09760.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-15901,
author = {Zixian Guo and
Yuxiang Wei and
Ming Liu and
Zhilong Ji and
Jinfeng Bai and
Yiwen Guo and
Wangmeng Zuo},
title = {Black-Box Tuning of Vision-Language Models with Effective Gradient
Approximation},
journal = {CoRR},
volume = {abs/2312.15901},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.15901},
doi = {10.48550/ARXIV.2312.15901},
eprinttype = {arXiv},
eprint = {2312.15901},
timestamp = {Wed, 17 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-15901.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-16909,
author = {Jin Mao and
Ke Xiong and
Ming Liu and
Zhijin Qin and
Wei Chen and
Pingyi Fan and
Khaled Ben Letaief},
title = {A GAN-based Semantic Communication for Text without {CSI}},
journal = {CoRR},
volume = {abs/2312.16909},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.16909},
doi = {10.48550/ARXIV.2312.16909},
eprinttype = {arXiv},
eprint = {2312.16909},
timestamp = {Fri, 19 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-16909.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/basesearch/Liu22a,
author = {Ming Liu},
title = {Enhancing inverse Modeling in hydrogeology with Modern Machine Learning
Algorithms},
school = {Georgia Institute of Technology, Atlanta, GA, {USA}},
year = {2022},
url = {http://hdl.handle.net/1853/67149},
timestamp = {Fri, 30 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/basesearch/Liu22a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/apin/YiDLZHK22,
author = {Weichao Yi and
Liquan Dong and
Ming Liu and
Yuejin Zhao and
Mei Hui and
Lingqin Kong},
title = {Gated residual feature attention network for real-time Dehazing},
journal = {Appl. Intell.},
volume = {52},
number = {15},
pages = {17449--17464},
year = {2022},
url = {https://doi.org/10.1007/s10489-022-03157-4},
doi = {10.1007/S10489-022-03157-4},
timestamp = {Tue, 29 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/apin/YiDLZHK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cee/PuthalWNLSSYPEP22,
author = {Deepak Puthal and
Stanly Wilson and
Ashish Nanda and
Ming Liu and
Srinibas Swain and
Biswa P. S. Sahoo and
Kumar Yelamarthi and
Prashant Pillai and
Hesham El{-}Sayed and
Mukesh Prasad},
title = {Decision tree based user-centric security solution for critical IoT
infrastructure},
journal = {Comput. Electr. Eng.},
volume = {99},
pages = {107754},
year = {2022},
url = {https://doi.org/10.1016/j.compeleceng.2022.107754},
doi = {10.1016/J.COMPELECENG.2022.107754},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cee/PuthalWNLSSYPEP22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/di/WangLCC22,
author = {Tianyi Wang and
Ming Liu and
Wei Cao and
Kam{-}Pui Chow},
title = {Deepfake noise investigation and detection},
journal = {Digit. Investig.},
volume = {42},
number = {Supplement},
pages = {301395},
year = {2022},
url = {https://doi.org/10.1016/j.fsidi.2022.301395},
doi = {10.1016/J.FSIDI.2022.301395},
timestamp = {Mon, 28 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/di/WangLCC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eaai/HeLXYDXHL22,
author = {Cong He and
Ming Liu and
Peng Xiong and
Jianli Yang and
Haiman Du and
Jinpeng Xu and
Zengguang Hou and
Xiuling Liu},
title = {Localization of myocardial infarction using a multi-branch weight
sharing network based on 2-D vectorcardiogram},
journal = {Eng. Appl. Artif. Intell.},
volume = {116},
pages = {105428},
year = {2022},
url = {https://doi.org/10.1016/j.engappai.2022.105428},
doi = {10.1016/J.ENGAPPAI.2022.105428},
timestamp = {Sat, 19 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eaai/HeLXYDXHL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdst/ChangWLL22,
author = {Ying Chang and
Lan Wang and
Lingjie Lin and
Ming Liu},
title = {Deep Neural Network for Electromyography Signal Classification via
Wearable Sensors},
journal = {Int. J. Distributed Syst. Technol.},
volume = {13},
number = {3},
pages = {1--11},
year = {2022},
url = {https://doi.org/10.4018/ijdst.307988},
doi = {10.4018/IJDST.307988},
timestamp = {Fri, 11 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijdst/ChangWLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijgi/ZhouLZW22,
author = {Lei Zhou and
Ming Liu and
Zhenlong Zheng and
Wei Wang},
title = {Quantification of Spatial Association between Commercial and Residential
Spaces in Beijing Using Urban Big Data},
journal = {{ISPRS} Int. J. Geo Inf.},
volume = {11},
number = {4},
pages = {249},
year = {2022},
url = {https://doi.org/10.3390/ijgi11040249},
doi = {10.3390/IJGI11040249},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijgi/ZhouLZW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijis/WangLLLW22,
author = {Yilei Wang and
Tao Li and
Ming Liu and
Chunmei Li and
Hui Wang},
title = {{STSIIML:} Study on token shuffling under incomplete information based
on machine learning},
journal = {Int. J. Intell. Syst.},
volume = {37},
number = {12},
pages = {11078--11100},
year = {2022},
url = {https://doi.org/10.1002/int.23033},
doi = {10.1002/INT.23033},
timestamp = {Fri, 19 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijis/WangLLLW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/information/ZhangMYRL22,
author = {Sitao Zhang and
Kainan Ma and
Yibo Yin and
Binbin Ren and
Ming Liu},
title = {A Personalized Compression Method for Steady-State Visual Evoked Potential
{EEG} Signals},
journal = {Inf.},
volume = {13},
number = {4},
pages = {186},
year = {2022},
url = {https://doi.org/10.3390/info13040186},
doi = {10.3390/INFO13040186},
timestamp = {Mon, 13 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/information/ZhangMYRL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamc/LiuLX22,
author = {Yu Liu and
Ming Liu and
Xiaofeng Xu},
title = {Dynamics analysis of stochastic modified Leslie-Gower model with time-delay
and Michaelis-Menten type prey harvest},
journal = {J. Appl. Math. Comput.},
volume = {68},
number = {3},
pages = {2097--2124},
year = {2022},
url = {https://doi.org/10.1007/s12190-021-01612-y},
doi = {10.1007/S12190-021-01612-Y},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamc/LiuLX22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfi/DongYKL22,
author = {Hanlin Dong and
Xuebo Yang and
Zhian Kuang and
Ming Liu},
title = {On practical terminal sliding-mode control for systems with or without
mismatched uncertainty},
journal = {J. Frankl. Inst.},
volume = {359},
number = {15},
pages = {8084--8106},
year = {2022},
url = {https://doi.org/10.1016/j.jfranklin.2022.07.007},
doi = {10.1016/J.JFRANKLIN.2022.07.007},
timestamp = {Sun, 13 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jfi/DongYKL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jzusc/DongLJ22,
author = {Minggang Dong and
Ming Liu and
Chao Jing},
title = {One-against-all-based Hellinger distance decision tree for multiclass
imbalanced learning},
journal = {Frontiers Inf. Technol. Electron. Eng.},
volume = {23},
number = {2},
pages = {278--290},
year = {2022},
url = {https://doi.org/10.1631/FITEE.2000417},
doi = {10.1631/FITEE.2000417},
timestamp = {Fri, 01 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jzusc/DongLJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lgrs/LiuRSYS22,
author = {Ming Liu and
Dong Ren and
Hang Sun and
Simon X. Yang and
Pan Shao},
title = {Orchard Areas Segmentation in Remote Sensing Images via Class Feature
Aggregate Discriminator},
journal = {{IEEE} Geosci. Remote. Sens. Lett.},
volume = {19},
pages = {1--5},
year = {2022},
url = {https://doi.org/10.1109/LGRS.2022.3213679},
doi = {10.1109/LGRS.2022.3213679},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/lgrs/LiuRSYS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lgrs/WangLYLDCLY22,
author = {Yan Wang and
Ming Liu and
Yuexin Yang and
Zhaokui Li and
Qian Du and
Yushi Chen and
Fei Li and
Haibo Yang},
title = {Heterogeneous Few-Shot Learning for Hyperspectral Image Classification},
journal = {{IEEE} Geosci. Remote. Sens. Lett.},
volume = {19},
pages = {1--5},
year = {2022},
url = {https://doi.org/10.1109/LGRS.2021.3117577},
doi = {10.1109/LGRS.2021.3117577},
timestamp = {Thu, 07 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/lgrs/WangLYLDCLY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/monet/LiuGWSZW22,
author = {Ming Liu and
Mingxiang Guan and
Zhou Wu and
Chongwu Sun and
Weifeng Zhang and
Mingjiang Wang},
title = {High-Speed {VLSI} Implementation of an Improved Parallel Delayed {LMS}
Algorithm},
journal = {Mob. Networks Appl.},
volume = {27},
number = {4},
pages = {1593--1603},
year = {2022},
url = {https://doi.org/10.1007/s11036-021-01877-4},
doi = {10.1007/S11036-021-01877-4},
timestamp = {Wed, 06 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/monet/LiuGWSZW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/YiDLZHK22,
author = {Weichao Yi and
Liquan Dong and
Ming Liu and
Yuejin Zhao and
Mei Hui and
Lingqin Kong},
title = {DCNet: dual-cascade network for single image dehazing},
journal = {Neural Comput. Appl.},
volume = {34},
number = {19},
pages = {16771--16783},
year = {2022},
url = {https://doi.org/10.1007/s00521-022-07319-w},
doi = {10.1007/S00521-022-07319-W},
timestamp = {Wed, 05 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nca/YiDLZHK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nn/XuLZ22,
author = {Huawei Xu and
Ming Liu and
Delong Zhang},
title = {How does the brain represent the semantic content of an image?},
journal = {Neural Networks},
volume = {154},
pages = {31--42},
year = {2022},
url = {https://doi.org/10.1016/j.neunet.2022.06.034},
doi = {10.1016/J.NEUNET.2022.06.034},
timestamp = {Tue, 18 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nn/XuLZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/LiuZLLPTJLLL22,
author = {Ming Liu and
Baogang Zhang and
Tong Luo and
Yue Liu and
Boris A. Portnov and
Tamar Trop and
Weili Jiao and
Huichan Liu and
Yiwei Li and
Qingyuan Liu},
title = {Evaluating Street Lighting Quality in Residential Areas by Combining
Remote Sensing Tools and a Survey on Pedestrians' Perceptions of Safety
and Visual Comfort},
journal = {Remote. Sens.},
volume = {14},
number = {4},
pages = {826},
year = {2022},
url = {https://doi.org/10.3390/rs14040826},
doi = {10.3390/RS14040826},
timestamp = {Fri, 01 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/LiuZLLPTJLLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/SunZLLYL22,
author = {Hezhi Sun and
Ke Zheng and
Ming Liu and
Chao Li and
Dong Yang and
Jindong Li},
title = {Hyperspectral Image Mixed Noise Removal Using a Subspace Projection
Attention and Residual Channel Attention Network},
journal = {Remote. Sens.},
volume = {14},
number = {9},
pages = {2071},
year = {2022},
url = {https://doi.org/10.3390/rs14092071},
doi = {10.3390/RS14092071},
timestamp = {Thu, 02 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/SunZLLYL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/ZhangLLLLLFJ22,
author = {Baogang Zhang and
Yiwei Li and
Ming Liu and
Yuchuan Liu and
Tong Luo and
Qingyuan Liu and
Lie Feng and
Weili Jiao},
title = {Research on Inversion and Correction Method of Urban Light Environment
Based on Cooperative Observation},
journal = {Remote. Sens.},
volume = {14},
number = {12},
pages = {2888},
year = {2022},
url = {https://doi.org/10.3390/rs14122888},
doi = {10.3390/RS14122888},
timestamp = {Tue, 28 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/ZhangLLLLLFJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/LiuSBGE22,
author = {Ming Liu and
Qiyu Sun and
Dustin E. Brewer and
Thomas M. Gehring and
Jesse Eickholt},
title = {An Ornithologist's Guide for Including Machine Learning in a Workflow
to Identify a Secretive Focal Species from Recorded Audio},
journal = {Remote. Sens.},
volume = {14},
number = {15},
pages = {3816},
year = {2022},
url = {https://doi.org/10.3390/rs14153816},
doi = {10.3390/RS14153816},
timestamp = {Mon, 26 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/LiuSBGE22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/LiuRSY22,
author = {Ming Liu and
Dong Ren and
Hang Sun and
Simon X. Yang},
title = {Multibranch Unsupervised Domain Adaptation Network for Cross Multidomain
Orchard Area Segmentation},
journal = {Remote. Sens.},
volume = {14},
number = {19},
pages = {4915},
year = {2022},
url = {https://doi.org/10.3390/rs14194915},
doi = {10.3390/RS14194915},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/LiuRSY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/SuMZL22,
author = {Yue Su and
Kainan Ma and
Xu Zhang and
Ming Liu},
title = {Neural Network-Enabled Flexible Pressure and Temperature Sensor with
Honeycomb-like Architecture for Voice Recognition},
journal = {Sensors},
volume = {22},
number = {3},
pages = {759},
year = {2022},
url = {https://doi.org/10.3390/s22030759},
doi = {10.3390/S22030759},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/SuMZL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/XuZMLL22,
author = {Jie Xu and
Zhengyang Zhao and
Qian Ma and
Ming Liu and
Giuseppe Lacidogna},
title = {Damage Diagnosis of Single-Layer Latticed Shell Based on Temperature-Induced
Strain under Bayesian Framework},
journal = {Sensors},
volume = {22},
number = {11},
pages = {4251},
year = {2022},
url = {https://doi.org/10.3390/s22114251},
doi = {10.3390/S22114251},
timestamp = {Mon, 26 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/XuZMLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simpra/TianZLLHH22,
author = {Ying Tian and
Ming Zhao and
Ming Liu and
Yajing Liao and
Chong Huang and
Mingyao Hu},
title = {Hybrid modeling methodology for integrating customers' behaviors into
system simulation to improve service operations management},
journal = {Simul. Model. Pract. Theory},
volume = {115},
pages = {102445},
year = {2022},
url = {https://doi.org/10.1016/j.simpat.2021.102445},
doi = {10.1016/J.SIMPAT.2021.102445},
timestamp = {Thu, 28 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simpra/TianZLLHH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/ZhengPCLYHR22,
author = {Cheng Zheng and
Baochai Peng and
Bangqing Chen and
Ming Liu and
Wenchang Yu and
Yuyan He and
Dong Ren},
title = {Multiscale Fusion Network for Rural Newly Constructed Building Detection
in Unmanned Aerial Vehicle Imagery},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {15},
pages = {9160--9173},
year = {2022},
url = {https://doi.org/10.1109/JSTARS.2022.3209682},
doi = {10.1109/JSTARS.2022.3209682},
timestamp = {Sun, 13 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/staeors/ZhengPCLYHR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/LiLCXLD22,
author = {Zhaokui Li and
Ming Liu and
Yushi Chen and
Yimin Xu and
Wei Li and
Qian Du},
title = {Deep Cross-Domain Few-Shot Learning for Hyperspectral Image Classification},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {60},
pages = {1--18},
year = {2022},
url = {https://doi.org/10.1109/TGRS.2021.3057066},
doi = {10.1109/TGRS.2021.3057066},
timestamp = {Mon, 04 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/LiLCXLD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/LiuSLO22,
author = {Ming Liu and
Zhongqiu Sun and
Shan Lu and
Kenji Omasa},
title = {Combining Multiangular, Polarimetric, and Hyperspectral Measurements
to Estimate Leaf Nitrogen Concentration From Different Plant Species},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {60},
pages = {1--15},
year = {2022},
url = {https://doi.org/10.1109/TGRS.2021.3106786},
doi = {10.1109/TGRS.2021.3106786},
timestamp = {Wed, 23 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgrs/LiuSLO22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/ChengLYRC22,
author = {Chao Cheng and
Ming Liu and
Hui Yi and
Guangtao Ran and
Hongtian Chen},
title = {Slow Manifold Analysis-Based Detection of Hot Spots in Photovoltaic
Systems},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {71},
pages = {1--10},
year = {2022},
url = {https://doi.org/10.1109/TIM.2022.3187700},
doi = {10.1109/TIM.2022.3187700},
timestamp = {Mon, 08 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tim/ChengLYRC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/HuangHCWNZWWHLC22,
author = {Xing Huang and
Xinning Hu and
Chunyan Cui and
Hao Wang and
Feifei Niu and
Yuan Zhang and
Luzhong Wang and
Qiuliang Wang and
Xinghua Hao and
Ming Liu and
Xiaodong Chen and
Yan Yang},
title = {Design and Construction of a Superconducting Gravimeter Prototype},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {71},
pages = {1--10},
year = {2022},
url = {https://doi.org/10.1109/TIM.2022.3147885},
doi = {10.1109/TIM.2022.3147885},
timestamp = {Mon, 15 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tim/HuangHCWNZWWHLC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/RanYL0CZ022,
author = {Shaolin Ran and
Xiaoyun Yang and
Ming Liu and
Yong Zhang and
Cheng Cheng and
Hongling Zhu and
Ye Yuan},
title = {Homecare-Oriented {ECG} Diagnosis With Large-Scale Deep Neural Network
for Continuous Monitoring on Embedded Devices},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {71},
pages = {1--13},
year = {2022},
url = {https://doi.org/10.1109/TIM.2022.3147328},
doi = {10.1109/TIM.2022.3147328},
timestamp = {Tue, 15 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tim/RanYL0CZ022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/WangWLMGXMWWJHL22,
author = {Liqian Wang and
Jingen Wu and
Jiaming Liu and
Ruohao Mao and
Mengmeng Guan and
Dan Xian and
Qi Mao and
Chenying Wang and
Zhiguang Wang and
Zhuangde Jiang and
Zhongqiang Hu and
Ming Liu},
title = {A Magnetic Field Imaging System Based on {TMR} Sensors for Banknote
Recognition},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {71},
pages = {1--9},
year = {2022},
url = {https://doi.org/10.1109/TIM.2022.3170987},
doi = {10.1109/TIM.2022.3170987},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tim/WangWLMGXMWWJHL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/ZhangLXDZSHL22,
author = {Jieshuo Zhang and
Ming Liu and
Peng Xiong and
Haiman Du and
Hong Zhang and
Guoming Sun and
Zengguang Hou and
Xiuling Liu},
title = {Automated Localization of Myocardial Infarction of Image-Based Multilead
{ECG} Tensor With Tucker2 Decomposition},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {71},
pages = {1--15},
year = {2022},
url = {https://doi.org/10.1109/TIM.2021.3104394},
doi = {10.1109/TIM.2021.3104394},
timestamp = {Tue, 15 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tim/ZhangLXDZSHL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amlts/HuangZL22,
author = {Kan Huang and
Kai Zhang and
Ming Liu},
editor = {Wei Liu and
Linsey Pang},
title = {GreenEyes: An Air Quality Evaluating Model based on WaveNet},
booktitle = {Proceedings of the Workshop on Applied Machine Learning Methods for
Time Series Forecasting {(AMLTS} 2022) co-located with 31st {ACM}
International Conference on Information and Knowledge Management {(CIKM}
2022), Atlanta, Georgia, USA, October 21, 2022},
series = {{CEUR} Workshop Proceedings},
volume = {3375},
publisher = {CEUR-WS.org},
year = {2022},
url = {https://ceur-ws.org/Vol-3375/paper5.pdf},
timestamp = {Wed, 03 May 2023 17:10:38 +0200},
biburl = {https://dblp.org/rec/conf/amlts/HuangZL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cncert/ZhangCL22,
author = {Yanjing Zhang and
Jianming Cui and
Ming Liu},
editor = {Wei Lu and
Yuqing Zhang and
Weiping Wen and
Hanbing Yan and
Chao Li},
title = {Research on Adversarial Patch Attack Defense Method for Traffic Sign
Detection},
booktitle = {Cyber Security - 19th China Annual Conference, {CNCERT} 2022, Beijing,
China, August 16-17, 2022, Revised Selected Papers},
series = {Communications in Computer and Information Science},
volume = {1699},
pages = {199--210},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-981-19-8285-9\_15},
doi = {10.1007/978-981-19-8285-9\_15},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cncert/ZhangCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dtpi/GaoZWGGL22,
author = {Lin Gao and
Pan Zhao and
Lin Wang and
Haidong Gao and
Yaokui Gao and
Ming Liu},
title = {A Novel Recurrent Neural Network for Dynamic Process Modeling with
Inertia and Delay},
booktitle = {{IEEE} 2nd International Conference on Digital Twins and Parallel
Intelligence, {DTPI} 2022, Boston, MA, USA, October 24-28, 2022},
pages = {1--6},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/DTPI55838.2022.9998948},
doi = {10.1109/DTPI55838.2022.9998948},
timestamp = {Thu, 22 Feb 2024 11:27:26 +0100},
biburl = {https://dblp.org/rec/conf/dtpi/GaoZWGGL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/CondeTHPCLPSBLFWLZLJAWLCLYZLLZJKZZZLMS22,
author = {Marcos V. Conde and
Radu Timofte and
Yibin Huang and
Jingyang Peng and
Chang Chen and
Cheng Li and
Eduardo P{\'{e}}rez{-}Pellitero and
Fenglong Song and
Furui Bai and
Shuai Liu and
Chaoyu Feng and
Xiaotao Wang and
Lei Lei and
Yu Zhu and
Chenghua Li and
Yingying Jiang and
Yong A and
Peisong Wang and
Cong Leng and
Jian Cheng and
Xiaoyu Liu and
Zhicun Yin and
Zhilu Zhang and
Junyi Li and
Ming Liu and
Wangmeng Zuo and
Jun Jiang and
Jinha Kim and
Yue Zhang and
Beiji Zou and
Zhikai Zong and
Xiaoxiao Liu and
Juan Mar{\'{\i}}n{-}Vega and
Michael Sloth and
Peter Schneider{-}Kamp and
Richard R{\"{o}}ttger and
Furkan Kinli and
Baris {\"{O}}zcan and
Furkan Kira{\c{c}} and
Li Leyi and
S. M. Nadim Uddin and
Dipon Kumar Ghosh and
Yong Ju Jung},
editor = {Leonid Karlinsky and
Tomer Michaeli and
Ko Nishino},
title = {Reversed Image Signal Processing and {RAW} Reconstruction. {AIM} 2022
Challenge Report},
booktitle = {Computer Vision - {ECCV} 2022 Workshops - Tel Aviv, Israel, October
23-27, 2022, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {13803},
pages = {3--26},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-25066-8\_1},
doi = {10.1007/978-3-031-25066-8\_1},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eccv/CondeTHPCLPSBLFWLZLJAWLCLYZLLZJKZZZLMS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/FengLZSZJYLGZWFHHLCDZHLWJJSWLZZZGWRHFH22,
author = {Ruicheng Feng and
Chongyi Li and
Shangchen Zhou and
Wenxiu Sun and
Qingpeng Zhu and
Jun Jiang and
Qingyu Yang and
Chen Change Loy and
Jinwei Gu and
Yurui Zhu and
Xi Wang and
Xueyang Fu and
Xiaowei Hu and
Jinfan Hu and
Xina Liu and
Xiangyu Chen and
Chao Dong and
Dafeng Zhang and
Feiyu Huang and
Shizhuo Liu and
Xiaobing Wang and
Zhezhu Jin and
Xuhao Jiang and
Guangqi Shao and
Xiaotao Wang and
Lei Lei and
Zhao Zhang and
Suiyi Zhao and
Huan Zheng and
Yangcheng Gao and
Yanyan Wei and
Jiahuan Ren and
Tao Huang and
Zhenxuan Fang and
Mengluan Huang and
Junwei Xu and
Yong Zhang and
Yuechi Yang and
Qidi Shu and
Zhiwen Yang and
Shaocong Li and
Mingde Yao and
Ruikang Xu and
Yuanshen Guan and
Jie Huang and
Zhiwei Xiong and
Hangyan Zhu and
Ming Liu and
Shaohui Liu and
Wangmeng Zuo and
Zhuang Jia and
Binbin Song and
Ziqi Song and
Guiting Mao and
Ben Hou and
Zhimou Liu and
Yi Ke and
Dengpei Ouyang and
Dekui Han and
Jinghao Zhang and
Qi Zhu and
Naishan Zheng and
Feng Zhao and
Wu Jin and
Marcos V. Conde and
Sabari Nathan and
Radu Timofte and
Tianyi Xu and
Jun Xu and
P. S. Hrishikesh and
Densen Puthussery and
C. V. Jiji and
Biao Jiang and
Yuhan Ding and
WanZhang Li and
Xiaoyue Feng and
Sijing Chen and
Tianheng Zhong and
Jiyang Lu and
Hongming Chen and
Zhentao Fan and
Xiang Chen},
editor = {Leonid Karlinsky and
Tomer Michaeli and
Ko Nishino},
title = {{MIPI} 2022 Challenge on Under-Display Camera Image Restoration: Methods
and Results},
booktitle = {Computer Vision - {ECCV} 2022 Workshops - Tel Aviv, Israel, October
23-27, 2022, Proceedings, Part {V}},
series = {Lecture Notes in Computer Science},
volume = {13805},
pages = {60--77},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-25072-9\_5},
doi = {10.1007/978-3-031-25072-9\_5},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eccv/FengLZSZJYLGZWFHHLCDZHLWJJSWLZZZGWRHFH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fedcsis/RutaLCV22,
author = {Dymitr Ruta and
Ming Liu and
Ling Cen and
Quang Hieu Vu},
editor = {Maria Ganzha and
Leszek A. Maciaszek and
Marcin Paprzycki and
Dominik Slezak},
title = {Diversified gradient boosting ensembles for prediction of the cost
of forwarding contracts},
booktitle = {Proceedings of the 17th Conference on Computer Science and Intelligence
Systems, FedCSIS 2022, Sofia, Bulgaria, September 4-7, 2022},
series = {Annals of Computer Science and Information Systems},
volume = {30},
pages = {431--436},
year = {2022},
url = {https://doi.org/10.15439/2022F291},
doi = {10.15439/2022F291},
timestamp = {Tue, 23 Apr 2024 09:47:30 +0200},
biburl = {https://dblp.org/rec/conf/fedcsis/RutaLCV22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fedcsis/VuCRL22,
author = {Quang Hieu Vu and
Ling Cen and
Dymitr Ruta and
Ming Liu},
editor = {Maria Ganzha and
Leszek A. Maciaszek and
Marcin Paprzycki and
Dominik Slezak},
title = {Key Factors to Consider when Predicting the Costs of Forwarding Contracts},
booktitle = {Proceedings of the 17th Conference on Computer Science and Intelligence
Systems, FedCSIS 2022, Sofia, Bulgaria, September 4-7, 2022},
series = {Annals of Computer Science and Information Systems},
volume = {30},
pages = {447--450},
year = {2022},
url = {https://doi.org/10.15439/2022F293},
doi = {10.15439/2022F293},
timestamp = {Fri, 07 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fedcsis/VuCRL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/Che0H0SDL22,
author = {Jingze Che and
Zhaoyang Zhang and
Yingzhi Huang and
Zhaohui Yang and
Hangguan Shan and
Zhiji Deng and
Ming Liu},
title = {Unsourced Random Access for Distributed State Monitoring in Internet
of Things},
booktitle = {{IEEE} Globecom 2022 Workshops, Rio de Janeiro, Brazil, December 4-8,
2022},
pages = {656--661},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/GCWkshps56602.2022.10008765},
doi = {10.1109/GCWKSHPS56602.2022.10008765},
timestamp = {Tue, 17 Jan 2023 14:32:06 +0100},
biburl = {https://dblp.org/rec/conf/globecom/Che0H0SDL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icait/DuLLLCLZYW22,
author = {Ye Du and
Yan Li and
Ming Liu and
Ting Lei and
Chao Chen and
Wei Li and
Yong Zuo and
Zhisheng Yang and
Jian Wu},
title = {The Performance and Comparision of Turbulence Compensation between
Adaptive Optics with and without {WFS} under Dynamic Turbulence},
booktitle = {14th {IEEE} International Conference on Advanced Infocomm Technology,
{ICAIT} 2022, Chongqing, China, July 8-11, 2022},
pages = {79--84},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICAIT56197.2022.9862669},
doi = {10.1109/ICAIT56197.2022.9862669},
timestamp = {Mon, 20 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icait/DuLLLCLZYW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icccv/Liu022,
author = {Ming Liu and
Wei Qi Yan},
title = {Masked Face Recognition Using MobileNetV2},
booktitle = {2022 The 5th International Conference on Control and Computer Vision,
{ICCCV} 2022, Xiamen, China, August 19-21, 2022},
pages = {134--138},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3561613.3561650},
doi = {10.1145/3561613.3561650},
timestamp = {Fri, 11 Nov 2022 10:45:47 +0100},
biburl = {https://dblp.org/rec/conf/icccv/Liu022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ZhangZPL22,
author = {Boning Zhang and
Xiaokang Zhang and
Man{-}On Pun and
Ming Liu},
title = {Prototype-Based Clustered Federated Learning for Semantic Segmentation
of Aerial Images},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2022, Kuala Lumpur, Malaysia, July 17-22, 2022},
pages = {2227--2230},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IGARSS46834.2022.9883127},
doi = {10.1109/IGARSS46834.2022.9883127},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/ZhangZPL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/MaZPL22,
author = {Xianping Ma and
Xiaokang Zhang and
Man{-}On Pun and
Ming Liu},
title = {{MSFNET:} Multi-Stage Fusion Network for Semantic Segmentation of
Fine-Resolution Remote Sensing Data},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2022, Kuala Lumpur, Malaysia, July 17-22, 2022},
pages = {2833--2836},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IGARSS46834.2022.9883789},
doi = {10.1109/IGARSS46834.2022.9883789},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/MaZPL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/WangSZYWLYJ22,
author = {Pengwei Wang and
Yinpei Su and
Xiaohuan Zhou and
Xin Ye and
Liangchen Wei and
Ming Liu and
Yuan You and
Feijun Jiang},
editor = {Hanseok Ko and
John H. L. Hansen},
title = {Speech2Slot: {A} Limited Generation Framework with Boundary Detection
for Slot Filling from Speech},
booktitle = {Interspeech 2022, 23rd Annual Conference of the International Speech
Communication Association, Incheon, Korea, 18-22 September 2022},
pages = {2748--2752},
publisher = {{ISCA}},
year = {2022},
url = {https://doi.org/10.21437/Interspeech.2022-11347},
doi = {10.21437/INTERSPEECH.2022-11347},
timestamp = {Wed, 21 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/WangSZYWLYJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/LiuHYL22,
author = {Hongji Liu and
Huajian Huang and
Sai{-}Kit Yeung and
Ming Liu},
title = {360ST-Mapping: An Online Semantics-Guided Topological Mapping Module
for Omnidirectional Visual {SLAM}},
booktitle = {{IEEE/RSJ} International Conference on Intelligent Robots and Systems,
{IROS} 2022, Kyoto, Japan, October 23-27, 2022},
pages = {802--807},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IROS47612.2022.9982142},
doi = {10.1109/IROS47612.2022.9982142},
timestamp = {Tue, 03 Jan 2023 14:18:21 +0100},
biburl = {https://dblp.org/rec/conf/iros/LiuHYL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/ChengXWL22,
author = {Jie Cheng and
Ren Xin and
Sheng Wang and
Ming Liu},
title = {{MPNP:} Multi-Policy Neural Planner for Urban Driving},
booktitle = {{IEEE/RSJ} International Conference on Intelligent Robots and Systems,
{IROS} 2022, Kyoto, Japan, October 23-27, 2022},
pages = {10549--10554},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IROS47612.2022.9982111},
doi = {10.1109/IROS47612.2022.9982111},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iros/ChengXWL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ZhuJZJWGWNZCWZZ22,
author = {Haozhe Zhu and
Bo Jiao and
Jinshan Zhang and
Xinru Jia and
Yunzhengmao Wang and
Tianchan Guan and
Shengcheng Wang and
Dimin Niu and
Hongzhong Zheng and
Chixiao Chen and
Mingyu Wang and
Lihua Zhang and
Xiaoyang Zeng and
Qi Liu and
Yuan Xie and
Ming Liu},
title = {{COMB-MCM:} Computing-on-Memory-Boundary {NN} Processor with Bipolar
Bitwise Sparsity Optimization for Scalable Multi-Chiplet-Module Edge
Machine Learning},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2022,
San Francisco, CA, USA, February 20-26, 2022},
pages = {1--3},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISSCC42614.2022.9731657},
doi = {10.1109/ISSCC42614.2022.9731657},
timestamp = {Fri, 04 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/ZhuJZJWGWNZCWZZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ithings/WangLLLW22,
author = {Yilei Wang and
Ming Liu and
Tao Li and
Chunmei Li and
Hui Wang},
title = {{TSHML:} Token Shuffling under Haircut Policy Based on Machine Learning},
booktitle = {2022 {IEEE} International Conferences on Internet of Things (iThings)
and {IEEE} Green Computing {\&} Communications (GreenCom) and
{IEEE} Cyber, Physical {\&} Social Computing (CPSCom) and {IEEE}
Smart Data (SmartData) and {IEEE} Congress on Cybermatics (Cybermatics),
Espoo, Finland, August 22-25, 2022},
pages = {401--405},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/iThings-GreenCom-CPSCom-SmartData-Cybermatics55523.2022.00090},
doi = {10.1109/ITHINGS-GREENCOM-CPSCOM-SMARTDATA-CYBERMATICS55523.2022.00090},
timestamp = {Wed, 26 Oct 2022 19:40:32 +0200},
biburl = {https://dblp.org/rec/conf/ithings/WangLLLW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itsc/XiongLYL22,
author = {Lu Xiong and
Ming Liu and
Xing Yang and
Bo Leng},
title = {Integrated Path Tracking for Autonomous Vehicle Collision Avoidance
Based on Model Predictive Control With Multi-constraints},
booktitle = {25th {IEEE} International Conference on Intelligent Transportation
Systems, {ITSC} 2022, Macau, China, October 8-12, 2022},
pages = {554--561},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ITSC55140.2022.9922466},
doi = {10.1109/ITSC55140.2022.9922466},
timestamp = {Thu, 10 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/itsc/XiongLYL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwqos/ZhaoDWCLXW22,
author = {Ruijie Zhao and
Xianwen Deng and
Yanhao Wang and
Libo Chen and
Ming Liu and
Zhi Xue and
Yijun Wang},
title = {Flow Sequence-Based Anonymity Network Traffic Identification with
Residual Graph Convolutional Networks},
booktitle = {30th {IEEE/ACM} International Symposium on Quality of Service, IWQoS
2022, Oslo, Norway, June 10-12, 2022},
pages = {1--10},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IWQoS54832.2022.9812882},
doi = {10.1109/IWQOS54832.2022.9812882},
timestamp = {Mon, 30 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iwqos/ZhaoDWCLXW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kaleidoscope/DengFLQDYKWZWL22,
author = {Zhiji Deng and
Zhewei Fu and
Ming Liu and
Xiangyu Qu and
Dong Ding and
Qi Ye and
Weisheng Kong and
Fei Wang and
Jinyu Zhang and
Hui Wang and
Jian Lou},
title = {Research and Standardization Requirements for 5G Network Peak Control
Technology in Video Transmission},
booktitle = {2022 {ITU} Kaleidoscope- Extended reality - How to boost quality of
experience and interoperability, Accra, Ghana, December 7-9, 2022},
pages = {1--7},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.23919/ITUK56368.2022.10003055},
doi = {10.23919/ITUK56368.2022.10003055},
timestamp = {Wed, 18 Jan 2023 19:02:45 +0100},
biburl = {https://dblp.org/rec/conf/kaleidoscope/DengFLQDYKWZWL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miip/GuoZWLCC22a,
author = {Chao Guo and
Weifang Zhu and
Meng Wang and
Ming Liu and
Zhongyue Chen and
Xinjian Chen},
editor = {Olivier Colliot and
Ivana Isgum and
Bennett A. Landman and
Murray H. Loew},
title = {Acute branch retinal artery occlusion segmentation based on Bayes
posterior probability and deep learning},
booktitle = {Medical Imaging 2022: Image Processing, San Diego, CA, USA, February
20-24, 2022 / Online, March 21-27, 2022},
series = {{SPIE} Proceedings},
volume = {12032},
publisher = {{SPIE}},
year = {2022},
url = {https://doi.org/10.1117/12.2611500},
doi = {10.1117/12.2611500},
timestamp = {Fri, 15 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/miip/GuoZWLCC22a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ml4cs/ZhangLGWWLS22,
author = {Yiting Zhang and
Ming Liu and
Jianan Guo and
Zhaojie Wang and
Yilei Wang and
Tiancai Liang and
Sunil Kumar Singh},
editor = {Yuan Xu and
Hongyang Yan and
Huang Teng and
Jun Cai and
Jin Li},
title = {Optimal Revenue Analysis of the Stubborn Mining Based on Markov Decision
Process},
booktitle = {Machine Learning for Cyber Security - 4th International Conference,
{ML4CS} 2022, Guangzhou, China, December 2-4, 2022, Proceedings, Part
{II}},
series = {Lecture Notes in Computer Science},
volume = {13656},
pages = {299--308},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-20099-1\_25},
doi = {10.1007/978-3-031-20099-1\_25},
timestamp = {Tue, 09 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ml4cs/ZhangLGWWLS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nlpcc/LiuZTZCXL22,
author = {Ming Liu and
He Zhang and
Yangjie Tian and
Tianrui Zong and
Borui Cai and
Ruohua Xu and
Yunfeng Li},
editor = {Wei Lu and
Shujian Huang and
Yu Hong and
Xiabing Zhou},
title = {Overview of {NLPCC2022} Shared Task 5 Track 1: Multi-label Classification
for Scientific Literature},
booktitle = {Natural Language Processing and Chinese Computing - 11th {CCF} International
Conference, {NLPCC} 2022, Guilin, China, September 24-25, 2022, Proceedings,
Part {II}},
series = {Lecture Notes in Computer Science},
volume = {13552},
pages = {320--327},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-17189-5\_28},
doi = {10.1007/978-3-031-17189-5\_28},
timestamp = {Tue, 27 Sep 2022 21:06:59 +0200},
biburl = {https://dblp.org/rec/conf/nlpcc/LiuZTZCXL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nlpcc/CaiZLLZCL22,
author = {Borui Cai and
He Zhang and
Fenghong Liu and
Ming Liu and
Tianrui Zong and
Zhe Chen and
Yunfeng Li},
editor = {Wei Lu and
Shujian Huang and
Yu Hong and
Xiabing Zhou},
title = {Overview of {NLPCC2022} Shared Task 5 Track 2: Named Entity Recognition},
booktitle = {Natural Language Processing and Chinese Computing - 11th {CCF} International
Conference, {NLPCC} 2022, Guilin, China, September 24-25, 2022, Proceedings,
Part {II}},
series = {Lecture Notes in Computer Science},
volume = {13552},
pages = {336--341},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-17189-5\_30},
doi = {10.1007/978-3-031-17189-5\_30},
timestamp = {Tue, 27 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nlpcc/CaiZLLZCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robio/MaWL22,
author = {Fulong Ma and
Sheng Wang and
Ming Liu},
title = {An Automatic Multi-LiDAR Extrinsic Calibration Algorithm Using Corner
Planes},
booktitle = {{IEEE} International Conference on Robotics and Biomimetics, {ROBIO}
2022, Jinghong, China, December 5-9, 2022},
pages = {235--240},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ROBIO55434.2022.10011672},
doi = {10.1109/ROBIO55434.2022.10011672},
timestamp = {Wed, 08 Feb 2023 17:46:11 +0100},
biburl = {https://dblp.org/rec/conf/robio/MaWL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semeval/Chu0C0L22,
author = {Zheng Chu and
Ziqing Yang and
Yiming Cui and
Zhigang Chen and
Ming Liu},
editor = {Guy Emerson and
Natalie Schluter and
Gabriel Stanovsky and
Ritesh Kumar and
Alexis Palmer and
Nathan Schneider and
Siddharth Singh and
Shyam Ratan},
title = {{HIT} at SemEval-2022 Task 2: Pre-trained Language Model for Idioms
Detection},
booktitle = {Proceedings of the 16th International Workshop on Semantic Evaluation,
SemEval@NAACL 2022, Seattle, Washington, United States, July 14-15,
2022},
pages = {221--227},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.semeval-1.28},
doi = {10.18653/V1/2022.SEMEVAL-1.28},
timestamp = {Mon, 01 Aug 2022 17:09:21 +0200},
biburl = {https://dblp.org/rec/conf/semeval/Chu0C0L22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/SunZYLGLDZWFXSL22,
author = {Wenxuan Sun and
Woyu Zhang and
Jie Yu and
Yi Li and
Zeyu Guo and
Jinru Lai and
Danian Dong and
Xu Zheng and
Fei Wang and
Shaoyang Fan and
Xiaoxin Xu and
Dashan Shang and
Ming Liu},
title = {3D Reservoir Computing with High Area Efficiency {(5.12} TOPS/mm\({}^{\mbox{2}}\))
Implemented by 3D Dynamic Memristor Array for Temporal Signal Processing},
booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits 2022), Honolulu, HI, USA, June 12-17, 2022},
pages = {222--223},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/VLSITechnologyandCir46769.2022.9830310},
doi = {10.1109/VLSITECHNOLOGYANDCIR46769.2022.9830310},
timestamp = {Thu, 30 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsit/SunZYLGLDZWFXSL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/HuangDFSLCJLSYS22,
author = {Kailiang Huang and
Xinlv Duan and
Junxiao Feng and
Ying Sun and
Congyan Lu and
Chuanke Chen and
Guangfan Jiao and
Xinpeng Lin and
Jinhai Shao and
Shihui Yin and
Jiazhen Sheng and
Zhaogui Wang and
Wenqiang Zhang and
Xichen Chuai and
Jiebin Niu and
Wenwu Wang and
Ying Wu and
Weiliang Jing and
Zhengbo Wang and
Jeffrey Xu and
Guanhua Yang and
Di Geng and
Ling Li and
Ming Liu},
title = {Vertical Channel-All-Around {(CAA)} {IGZO} {FET} under 50 nm {CD}
with High Read Current of 32.8 {\(\mu\)}A/{\(\mu\)}m (Vth + 1 V),
Well-performed Thermal Stability up to 120 {\unicode{8451}} for Low
Latency, High-density 2T0C 3D {DRAM} Application},
booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits 2022), Honolulu, HI, USA, June 12-17, 2022},
pages = {296--297},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/VLSITechnologyandCir46769.2022.9830271},
doi = {10.1109/VLSITECHNOLOGYANDCIR46769.2022.9830271},
timestamp = {Thu, 05 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsit/HuangDFSLCJLSYS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/ChenNYLLLHDLWWL22,
author = {Kaifei Chen and
Jiebin Niu and
Guanhua Yang and
Menggan Liu and
Wendong Lu and
Fuxi Liao and
Kailiang Huang and
XinLv Duan and
Congyan Lu and
Jiawei Wang and
Lingfei Wang and
Mengmeng Li and
Di Geng and
Chao Zhao and
Guilei Wang and
Nianduan Lu and
Ling Li and
Ming Liu},
title = {Scaling Dual-Gate Ultra-thin a-IGZO {FET} to 30 nm Channel Length
with Record-high Gm, max of 559 {\(\mathrm{\mu}\)}S/{\(\mathrm{\mu}\)}m
at VDS=1 V, Record-low {DIBL} of 10 mV/V and Nearly Ideal {SS} of
63 mV/dec},
booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits 2022), Honolulu, HI, USA, June 12-17, 2022},
pages = {298--299},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/VLSITechnologyandCir46769.2022.9830389},
doi = {10.1109/VLSITECHNOLOGYANDCIR46769.2022.9830389},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/ChenNYLLLHDLWWL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/GuoSWDHWFCHXGJY22,
author = {Jingrui Guo and
Ying Sun and
Lingfei Wang and
Xinlv Duan and
Kailiang Huang and
Zhaogui Wang and
Junxiao Feng and
Qian Chen and
Shijie Huang and
Lihua Xu and
Di Geng and
Guangfan Jiao and
Shihui Yin and
Zhengbo Wang and
Weiliang Jing and
Ling Li and
Ming Liu},
title = {Compact Modeling of IGZO-based CAA-FETs with Time-zero-instability
and {BTI} Impact on Device and Capacitor-less {DRAM} Retention Reliability},
booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits 2022), Honolulu, HI, USA, June 12-17, 2022},
pages = {300--301},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/VLSITechnologyandCir46769.2022.9830482},
doi = {10.1109/VLSITECHNOLOGYANDCIR46769.2022.9830482},
timestamp = {Thu, 04 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/GuoSWDHWFCHXGJY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/QinLYYWDZXZLLL22,
author = {Yuan Qin and
Congyan Lu and
Zhaoan Yu and
Zhihong Yao and
Feihong Wu and
Danian Dong and
Xiaolong Zhao and
Guangwei Xu and
Yuhao Zhang and
Shibing Long and
Ling Li and
Ming Liu},
title = {First Demonstration of High-Sensitivity {(NEP} 1fW\({}^{\mbox{1/2}}\))
Back-Illuminated Active-Matrix Deep {UV} Image Sensor by Monolithic
Integration of Ga2O3 Photodetectors and Oxide Thin-Film-Transistors},
booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits 2022), Honolulu, HI, USA, June 12-17, 2022},
pages = {345--346},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/VLSITechnologyandCir46769.2022.9830520},
doi = {10.1109/VLSITECHNOLOGYANDCIR46769.2022.9830520},
timestamp = {Thu, 04 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/QinLYYWDZXZLLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wocc/ChenYLL22,
author = {Eryan Chen and
Ling Ye and
Mingxing Liu and
Ming Liu},
title = {An Automated Framework for Change Detection with Contextual Understanding
Using Remote Sensing Data},
booktitle = {31st Wireless and Optical Communications Conference, {WOCC} 2022,
Shenzhen, China, August 11-12, 2022},
pages = {115--120},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/WOCC55104.2022.9880597},
doi = {10.1109/WOCC55104.2022.9880597},
timestamp = {Thu, 29 Sep 2022 21:52:19 +0200},
biburl = {https://dblp.org/rec/conf/wocc/ChenYLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/Liu22,
author = {Ming Liu},
title = {Student-AI question co-creation dataset},
publisher = {{IEEE} DataPort},
year = {2022},
month = dec,
howpublished = {\url{https://doi.org/10.21227/8wkq-3z53}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.21227/8wkq-3z53},
doi = {10.21227/8WKQ-3Z53},
timestamp = {Wed, 15 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/data/10/Liu22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2204-06145,
author = {Zheng Chu and
Ziqing Yang and
Yiming Cui and
Zhigang Chen and
Ming Liu},
title = {{HIT} at SemEval-2022 Task 2: Pre-trained Language Model for Idioms
Detection},
journal = {CoRR},
volume = {abs/2204.06145},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2204.06145},
doi = {10.48550/ARXIV.2204.06145},
eprinttype = {arXiv},
eprint = {2204.06145},
timestamp = {Fri, 29 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2204-06145.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-11783,
author = {Tianming Zheng and
Ming Liu and
Deepak Puthal and
Ping Yi and
Yue Wu and
Xiangjian He},
title = {Smart Grid: Cyber Attacks, Critical Defense Approaches, and Digital
Twin},
journal = {CoRR},
volume = {abs/2205.11783},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.11783},
doi = {10.48550/ARXIV.2205.11783},
eprinttype = {arXiv},
eprint = {2205.11783},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-11783.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2209-01774,
author = {Boyi Liu and
Lujia Wang and
Ming Liu},
title = {ElasticROS: An Elastically Collaborative Robot Operation System for
Fog and Cloud Robotics},
journal = {CoRR},
volume = {abs/2209.01774},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2209.01774},
doi = {10.48550/ARXIV.2209.01774},
eprinttype = {arXiv},
eprint = {2209.01774},
timestamp = {Thu, 16 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2209-01774.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-11153,
author = {Marcos V. Conde and
Radu Timofte and
Yibin Huang and
Jingyang Peng and
Chang Chen and
Cheng Li and
Eduardo P{\'{e}}rez{-}Pellitero and
Fenglong Song and
Furui Bai and
Shuai Liu and
Chaoyu Feng and
Xiaotao Wang and
Lei Lei and
Yu Zhu and
Chenghua Li and
Yingying Jiang and
Yong A and
Peisong Wang and
Cong Leng and
Jian Cheng and
Xiaoyu Liu and
Zhicun Yin and
Zhilu Zhang and
Junyi Li and
Ming Liu and
Wangmeng Zuo and
Jun Jiang and
Jinha Kim and
Yue Zhang and
Beiji Zou and
Zhikai Zong and
Xiaoxiao Liu and
Juan Mar{\'{\i}}n{-}Vega and
Michael Sloth and
Peter Schneider{-}Kamp and
Richard R{\"{o}}ttger and
Furkan Kinli and
Baris {\"{O}}zcan and
Furkan Kira{\c{c}} and
Li Leyi and
S. M. Nadim Uddin and
Dipon Kumar Ghosh and
Yong Ju Jung},
title = {Reversed Image Signal Processing and {RAW} Reconstruction. {AIM} 2022
Challenge Report},
journal = {CoRR},
volume = {abs/2210.11153},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.11153},
doi = {10.48550/ARXIV.2210.11153},
eprinttype = {arXiv},
eprint = {2210.11153},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-11153.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-11978,
author = {Shipeng Zhong and
Yuhua Qi and
Zhiqiang Chen and
Jin Wu and
Hongbo Chen and
Ming Liu},
title = {{DCL-SLAM:} {A} Distributed Collaborative LiDAR {SLAM} Framework for
a Robotic Swarm},
journal = {CoRR},
volume = {abs/2210.11978},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.11978},
doi = {10.48550/ARXIV.2210.11978},
eprinttype = {arXiv},
eprint = {2210.11978},
timestamp = {Tue, 25 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-11978.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-04175,
author = {Kan Huang and
Kai Zhang and
Ming Liu},
title = {GreenEyes: An Air Quality Evaluating Model based on WaveNet},
journal = {CoRR},
volume = {abs/2212.04175},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.04175},
doi = {10.48550/ARXIV.2212.04175},
eprinttype = {arXiv},
eprint = {2212.04175},
timestamp = {Mon, 02 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-04175.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/TengHZZLHLLXCDH21,
author = {Yan Teng and
Xiujun Hao and
Hong Zhu and
He Zhu and
Jiafeng Liu and
Yunlong Huai and
Meng Li and
Ming Liu and
Weirong Xing and
Baile Chen and
Zhuo Deng and
Yong Huang},
title = {Demonstration of MOCVD-Grown Long-Wavelength Infrared InAs/GaSb Superlattice
Focal Plane Array},
journal = {{IEEE} Access},
volume = {9},
pages = {60689--60694},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3072845},
doi = {10.1109/ACCESS.2021.3072845},
timestamp = {Thu, 29 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/TengHZZLHLLXCDH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/LuGWHL21,
author = {Liping Lu and
Zhe Guo and
Zhiqi Wang and
Zhonghua Huang and
Ming Liu},
title = {Parameter Estimation for a Capacitive Coupling Communication Channel
Within a Metal Cabinet Based on a Modified Artificial Immune Algorithm},
journal = {{IEEE} Access},
volume = {9},
pages = {75683--75698},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3082629},
doi = {10.1109/ACCESS.2021.3082629},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/LuGWHL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/YangLL21a,
author = {Zhi Yang and
Ming Liu and
Xiaochuan Luo},
title = {First-Optimize-Then-Discretize Strategy for the Parabolic {PDE} Constrained
Optimization Problem With Application to the Reheating Furnace},
journal = {{IEEE} Access},
volume = {9},
pages = {90283--90294},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3091149},
doi = {10.1109/ACCESS.2021.3091149},
timestamp = {Thu, 16 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/YangLL21a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bspc/LuWYSWZZCLPLC21,
author = {Yun Lu and
Mingjiang Wang and
Longxin Yao and
Hongcai Shen and
Wanqing Wu and
Qiquan Zhang and
Lu Zhang and
Moran Chen and
Hao Liu and
Rongchao Peng and
Ming Liu and
Shixiong Chen},
title = {Auditory attention decoding from electroencephalography based on long
short-term memory networks},
journal = {Biomed. Signal Process. Control.},
volume = {70},
pages = {102966},
year = {2021},
url = {https://doi.org/10.1016/j.bspc.2021.102966},
doi = {10.1016/J.BSPC.2021.102966},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bspc/LuWYSWZZCLPLC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/XiongXZLDZHWL21,
author = {Peng Xiong and
Yanping Xue and
Jieshuo Zhang and
Ming Liu and
Haiman Du and
Hong Zhang and
Zengguang Hou and
Hongrui Wang and
Xiuling Liu},
title = {Localization of myocardial infarction with multi-lead {ECG} based
on DenseNet},
journal = {Comput. Methods Programs Biomed.},
volume = {203},
pages = {106024},
year = {2021},
url = {https://doi.org/10.1016/j.cmpb.2021.106024},
doi = {10.1016/J.CMPB.2021.106024},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cmpb/XiongXZLDZHWL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cssp/XuWL21,
author = {Dongsheng Xu and
Ting Wang and
Ming Liu},
title = {Finite-time Synchronization of Fuzzy Cellular Neural Networks with
Stochastic Perturbations and Mixed Delays},
journal = {Circuits Syst. Signal Process.},
volume = {40},
number = {7},
pages = {3244--3265},
year = {2021},
url = {https://doi.org/10.1007/s00034-020-01631-3},
doi = {10.1007/S00034-020-01631-3},
timestamp = {Tue, 13 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cssp/XuWL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/digearth/ZhouLL21,
author = {Gaoxiang Zhou and
Ming Liu and
Xiangnan Liu},
title = {An autoencoder-based model for forest disturbance detection using
Landsat time series data},
journal = {Int. J. Digit. Earth},
volume = {14},
number = {9},
pages = {1087--1102},
year = {2021},
url = {https://doi.org/10.1080/17538947.2021.1949399},
doi = {10.1080/17538947.2021.1949399},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/digearth/ZhouLL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/displays/XiongZZLLDYL21,
author = {Peng Xiong and
Bing Zhang and
Jieshuo Zhang and
Jing Li and
Ming Liu and
Haiman Du and
Jianli Yang and
Xiuling Liu},
title = {Multi-grained cascade forest model for automatic {CAD} characterization
on {ECG} segments},
journal = {Displays},
volume = {70},
pages = {102070},
year = {2021},
url = {https://doi.org/10.1016/j.displa.2021.102070},
doi = {10.1016/J.DISPLA.2021.102070},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/displays/XiongZZLLDYL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eaai/ZhangLXDZLHL21,
author = {Jieshuo Zhang and
Ming Liu and
Peng Xiong and
Haiman Du and
Hong Zhang and
Feng Lin and
Zengguang Hou and
Xiuling Liu},
title = {A multi-dimensional association information analysis approach to automated
detection and localization of myocardial infarction},
journal = {Eng. Appl. Artif. Intell.},
volume = {97},
pages = {104092},
year = {2021},
url = {https://doi.org/10.1016/j.engappai.2020.104092},
doi = {10.1016/J.ENGAPPAI.2020.104092},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eaai/ZhangLXDZLHL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fi/ZhuLLZCM21,
author = {Qigang Zhu and
Yifan Liu and
Ming Liu and
Shuaishuai Zhang and
Guangyang Chen and
Hao Meng},
title = {Intelligent Planning and Research on Urban Traffic Congestion},
journal = {Future Internet},
volume = {13},
number = {11},
pages = {284},
year = {2021},
url = {https://doi.org/10.3390/fi13110284},
doi = {10.3390/FI13110284},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fi/ZhuLLZCM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fss/XuLL21,
author = {Dongsheng Xu and
Yu Liu and
Ming Liu},
title = {Finite-time synchronization of multi-coupling stochastic fuzzy neural
networks with mixed delays via feedback control},
journal = {Fuzzy Sets Syst.},
volume = {411},
pages = {85--104},
year = {2021},
url = {https://doi.org/10.1016/j.fss.2020.07.015},
doi = {10.1016/J.FSS.2020.07.015},
timestamp = {Tue, 06 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fss/XuLL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbc/LiuCX21,
author = {Ming Liu and
Jun Cao and
Xiaofeng Xu},
title = {Global Hopf Bifurcation in a Phytoplankton-Zooplankton System with
Delay and Diffusion},
journal = {Int. J. Bifurc. Chaos},
volume = {31},
number = {8},
pages = {2150114:1--2150114:14},
year = {2021},
url = {https://doi.org/10.1142/S0218127421501145},
doi = {10.1142/S0218127421501145},
timestamp = {Thu, 29 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijbc/LiuCX21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmic/MoLZL21,
author = {Yue Mo and
Ming Liu and
Feng Zheng and
Zetao Li},
title = {Research on fault isolation method for composite fault in power module
of modular multilevel converter},
journal = {Int. J. Model. Identif. Control.},
volume = {39},
number = {2},
pages = {83--96},
year = {2021},
url = {https://doi.org/10.1504/IJMIC.2021.123424},
doi = {10.1504/IJMIC.2021.123424},
timestamp = {Fri, 22 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmic/MoLZL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/information/LiuYMZL21,
author = {Tao Liu and
Yibo Yin and
Kainan Ma and
Sitao Zhang and
Ming Liu},
title = {Lightweight End-to-End Neural Network Model for Automatic Heart Sound
Classification},
journal = {Inf.},
volume = {12},
number = {2},
pages = {54},
year = {2021},
url = {https://doi.org/10.3390/info12020054},
doi = {10.3390/INFO12020054},
timestamp = {Wed, 07 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/information/LiuYMZL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/LiuDJ21,
author = {Ming Liu and
Minggang Dong and
Chao Jing},
title = {A modified real-value negative selection detector-based oversampling
approach for multiclass imbalance problems},
journal = {Inf. Sci.},
volume = {556},
pages = {160--176},
year = {2021},
url = {https://doi.org/10.1016/j.ins.2020.12.058},
doi = {10.1016/J.INS.2020.12.058},
timestamp = {Sat, 20 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/isci/LiuDJ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/monet/HeLLSWLT21,
author = {Peng He and
Ming Liu and
Chunhui Lan and
Mengnan Su and
Linhai Wang and
Zhidu Li and
Tong Tang},
title = {Distributed Power Controller of Massive Wireless Body Area Networks
based on Deep Reinforcement Learning},
journal = {Mob. Networks Appl.},
volume = {26},
number = {3},
pages = {1347--1358},
year = {2021},
url = {https://doi.org/10.1007/s11036-021-01751-3},
doi = {10.1007/S11036-021-01751-3},
timestamp = {Thu, 12 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/monet/HeLLSWLT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ojcomps/GeTZLGL21,
author = {Fei Ge and
Liansheng Tan and
Wei Zhang and
Ming Liu and
Xun Gao and
Juan Luo},
title = {Link Scheduling and End-to-End Throughput Optimization in Wireless
Multi-Hop Networks},
journal = {{IEEE} Open J. Comput. Soc.},
volume = {2},
pages = {393--406},
year = {2021},
url = {https://doi.org/10.1109/OJCS.2021.3121185},
doi = {10.1109/OJCS.2021.3121185},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ojcomps/GeTZLGL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/ZhangPL21,
author = {Xiaokang Zhang and
Man{-}On Pun and
Ming Liu},
title = {Semi-Supervised Multi-Temporal Deep Representation Fusion Network
for Landslide Mapping from Aerial Orthophotos},
journal = {Remote. Sens.},
volume = {13},
number = {4},
pages = {548},
year = {2021},
url = {https://doi.org/10.3390/rs13040548},
doi = {10.3390/RS13040548},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/remotesensing/ZhangPL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scientometrics/ZhangLWLY21,
author = {Li Zhang and
Ming Liu and
Bo Wang and
Bo Lang and
Peng Yang},
title = {Discovering communities based on mention distance},
journal = {Scientometrics},
volume = {126},
number = {3},
pages = {1945--1967},
year = {2021},
url = {https://doi.org/10.1007/s11192-021-03863-9},
doi = {10.1007/S11192-021-03863-9},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/scientometrics/ZhangLWLY21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sivp/YanZLKD21,
author = {Mi Yan and
Yuejin Zhao and
Ming Liu and
Lingqin Kong and
Liquan Dong},
title = {High-speed moving target tracking of multi-camera system with overlapped
field of view},
journal = {Signal Image Video Process.},
volume = {15},
number = {7},
pages = {1369--1377},
year = {2021},
url = {https://doi.org/10.1007/s11760-021-01867-9},
doi = {10.1007/S11760-021-01867-9},
timestamp = {Thu, 16 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sivp/YanZLKD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sp/WeiLLY21,
author = {Meiyu Wei and
Ming Liu and
Jie Liu and
Haitao Yang},
title = {A Comparison of Analgesic Effect between Preoperative and Postoperative
Transversus Abdominis Plane {(TAP)} Blocks for Different Durations
of Laparoscopic Gynecological Surgery},
journal = {Sci. Program.},
volume = {2021},
pages = {6668496:1--6668496:7},
year = {2021},
url = {https://doi.org/10.1155/2021/6668496},
doi = {10.1155/2021/6668496},
timestamp = {Mon, 17 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sp/WeiLLY21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/ZhangWZWL21,
author = {Lu Zhang and
Mingjiang Wang and
Qiquan Zhang and
Xinsheng Wang and
Ming Liu},
title = {PhaseDCN: {A} Phase-Enhanced Dual-Path Dilated Convolutional Network
for Single-Channel Speech Enhancement},
journal = {{IEEE} {ACM} Trans. Audio Speech Lang. Process.},
volume = {29},
pages = {2561--2574},
year = {2021},
url = {https://doi.org/10.1109/TASLP.2021.3092585},
doi = {10.1109/TASLP.2021.3092585},
timestamp = {Tue, 01 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/taslp/ZhangWZWL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/WuHGCZSWZDL21,
author = {Jingen Wu and
Zhongqiang Hu and
Xiangyu Gao and
Miaomiao Cheng and
Xinger Zhao and
Wei Su and
Zhiguang Wang and
Ziyao Zhou and
Shuxiang Dong and
Ming Liu},
title = {A Magnetoelectric Compass for In-Plane {AC} Magnetic Field Detection},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {68},
number = {4},
pages = {3527--3536},
year = {2021},
url = {https://doi.org/10.1109/TIE.2020.2978711},
doi = {10.1109/TIE.2020.2978711},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/WuHGCZSWZDL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/WangWSHCHWZL21,
author = {Zhiguang Wang and
Tao Wen and
Wei Su and
Chaojie Hu and
Yicheng Chen and
Zhongqiang Hu and
Jingen Wu and
Ziyao Zhou and
Ming Liu},
title = {Magnetic Sensor Based on Giant Magneto-Impedance in Commercial Inductors},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {68},
number = {8},
pages = {7577--7583},
year = {2021},
url = {https://doi.org/10.1109/TIE.2020.3007097},
doi = {10.1109/TIE.2020.3007097},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/WangWSHCHWZL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/adhocnets/TanJLZ21,
author = {Weicong Tan and
Yuan Jin and
Ming Liu and
He Zhang},
editor = {Wei Bao and
Xingliang Yuan and
Longxiang Gao and
Tom H. Luan and
David Bong Jun Choi},
title = {BiDKT: Deep Knowledge Tracing with {BERT}},
booktitle = {Ad Hoc Networks and Tools for {IT} - 13th {EAI} International Conference,
{ADHOCNETS} 2021, Virtual Event, December 6-7, 2021, and 16th {EAI}
International Conference, {TRIDENTCOM} 2021, Virtual Event, November
24, 2021, Proceedings},
series = {Lecture Notes of the Institute for Computer Sciences, Social Informatics
and Telecommunications Engineering},
volume = {428},
pages = {260--278},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-98005-4\_19},
doi = {10.1007/978-3-030-98005-4\_19},
timestamp = {Sun, 24 Mar 2024 20:30:33 +0100},
biburl = {https://dblp.org/rec/conf/adhocnets/TanJLZ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aipr2/HuangLSH21,
author = {Chengjian Huang and
Ming Liu and
Haizhou Sun and
Qingmao Hu},
title = {Non-contrast {CT} Image Automatic Diagnosis of Large Hemispheric Infarction
in Hyper-acute Phase Based on Convolutional Neural Network},
booktitle = {{AIPR} 2021: 4th International Conference on Artificial Intelligence
and Pattern Recognition, Xiamen, China, September 24 - 26, 2021},
pages = {295--302},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3488933.3488945},
doi = {10.1145/3488933.3488945},
timestamp = {Mon, 14 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aipr2/HuangLSH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asru/JiLFMZLZLJ21,
author = {Xuan Ji and
Lu Lu and
Fuming Fang and
Jianbo Ma and
Lei Zhu and
Jinke Li and
Dongdi Zhao and
Ming Liu and
Feijun Jiang},
title = {An End-to-End Far-Field Keyword Spotting System with Neural Beamforming},
booktitle = {{IEEE} Automatic Speech Recognition and Understanding Workshop, {ASRU}
2021, Cartagena, Colombia, December 13-17, 2021},
pages = {892--899},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ASRU51503.2021.9688326},
doi = {10.1109/ASRU51503.2021.9688326},
timestamp = {Sun, 24 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/asru/JiLFMZLZLJ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asscc/JiangZWZYWLLKR21,
author = {Xiping Jiang and
Fengguo Zuo and
Song Wang and
Xiaofeng Zhou and
Bing Yu and
Yubing Wang and
Qi Liu and
Ming Liu and
Yi Kang and
Qiwei Ren},
title = {A 1596GB/s 48Gb Embedded {DRAM} 384-Core SoC with Hybrid Bonding Integration},
booktitle = {{IEEE} Asian Solid-State Circuits Conference, {A-SSCC} 2021, Busan,
Korea, Republic of, November 7-10, 2021},
pages = {1--3},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/A-SSCC53895.2021.9634704},
doi = {10.1109/A-SSCC53895.2021.9634704},
timestamp = {Tue, 21 Dec 2021 17:54:16 +0100},
biburl = {https://dblp.org/rec/conf/asscc/JiangZWZYWLLKR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigdataconf/RutaCLV21,
author = {Dymitr Ruta and
Ling Cen and
Ming Liu and
Quang Hieu Vu},
editor = {Yixin Chen and
Heiko Ludwig and
Yicheng Tu and
Usama M. Fayyad and
Xingquan Zhu and
Xiaohua Hu and
Suren Byna and
Xiong Liu and
Jianping Zhang and
Shirui Pan and
Vagelis Papalexakis and
Jianwu Wang and
Alfredo Cuzzocrea and
Carlos Ordonez},
title = {Automated feature engineering for prediction of victories in online
computer games},
booktitle = {2021 {IEEE} International Conference on Big Data (Big Data), Orlando,
FL, USA, December 15-18, 2021},
pages = {5672--5678},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/BigData52589.2021.9671345},
doi = {10.1109/BIGDATA52589.2021.9671345},
timestamp = {Fri, 13 Jan 2023 17:06:49 +0100},
biburl = {https://dblp.org/rec/conf/bigdataconf/RutaCLV21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigdataconf/VuRCL21,
author = {Quang Hieu Vu and
Dymitr Ruta and
Ling Cen and
Ming Liu},
editor = {Yixin Chen and
Heiko Ludwig and
Yicheng Tu and
Usama M. Fayyad and
Xingquan Zhu and
Xiaohua Hu and
Suren Byna and
Xiong Liu and
Jianping Zhang and
Shirui Pan and
Vagelis Papalexakis and
Jianwu Wang and
Alfredo Cuzzocrea and
Carlos Ordonez},
title = {A combination of general and specific models to predict victories
in video games},
booktitle = {2021 {IEEE} International Conference on Big Data (Big Data), Orlando,
FL, USA, December 15-18, 2021},
pages = {5683--5690},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/BigData52589.2021.9671285},
doi = {10.1109/BIGDATA52589.2021.9671285},
timestamp = {Tue, 18 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bigdataconf/VuRCL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cncert/LiLXGWZ21,
author = {Ruiguang Li and
Ming Liu and
Dawei Xu and
Jiaqi Gao and
Fudong Wu and
Liehuang Zhu},
editor = {Wei Lu and
Yuqing Zhang and
Weiping Wen and
Hanbing Yan and
Chao Li},
title = {A Review of Machine Learning Algorithms for Text Classification},
booktitle = {Cyber Security - 18th China Annual Conference, {CNCERT} 2021, Beijing,
China, July 20-21, 2021, Revised Selected Papers},
series = {Communications in Computer and Information Science},
volume = {1506},
pages = {226--234},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-981-16-9229-1\_14},
doi = {10.1007/978-981-16-9229-1\_14},
timestamp = {Thu, 15 Dec 2022 13:09:15 +0100},
biburl = {https://dblp.org/rec/conf/cncert/LiLXGWZ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/confcds/GuLM21,
author = {Shipeng Gu and
Ming Liu and
Yaping Ma},
title = {Summary of Test Training Network},
booktitle = {{CONF-CDS} 2021: The 2nd International Conference on Computing and
Data Science, Stanford, CA, USA, January 28-30, 2021},
pages = {29:1--29:5},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3448734.3450481},
doi = {10.1145/3448734.3450481},
timestamp = {Thu, 20 May 2021 08:05:29 +0200},
biburl = {https://dblp.org/rec/conf/confcds/GuLM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csae/ZhangLX21,
author = {Zhao Zhang and
Ming Liu and
Wenquan Xu},
editor = {Ali Emrouznejad and
Jui{-}Sheng Rayson Chou},
title = {Spatial-Temporal Multi-Head Attention Networks for Traffic Flow Forecasting},
booktitle = {{CSAE} 2021: The 5th International Conference on Computer Science
and Application Engineering, Sanya, China, October 19 - 21, 2021},
pages = {27:1--27:7},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3487075.3487102},
doi = {10.1145/3487075.3487102},
timestamp = {Thu, 16 Dec 2021 10:16:15 +0100},
biburl = {https://dblp.org/rec/conf/csae/ZhangLX21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/Ma0L021,
author = {Ningning Ma and
Xiangyu Zhang and
Ming Liu and
Jian Sun},
title = {Activate or Not: Learning Customized Activation},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
2021, virtual, June 19-25, 2021},
pages = {8032--8042},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2021},
url = {https://openaccess.thecvf.com/content/CVPR2021/html/Ma\_Activate\_or\_Not\_Learning\_Customized\_Activation\_CVPR\_2021\_paper.html},
doi = {10.1109/CVPR46437.2021.00794},
timestamp = {Mon, 18 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/Ma0L021.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dmbd/WangGZLYWLL21,
author = {Zhaojie Wang and
Jianan Guo and
Yiting Zhang and
Ming Liu and
Liang Yan and
Yilei Wang and
Hailun Liu and
Yunhe Li},
editor = {Ying Tan and
Yuhui Shi and
Albert Y. Zomaya and
Hongyang Yan and
Jun Cai},
title = {{BSMRL:} Bribery Selfish Mining with Reinforcement Learning},
booktitle = {Data Mining and Big Data - 6th International Conference, {DMBD} 2021,
Guangzhou, China, October 20-22, 2021, Proceedings, Part {I}},
series = {Communications in Computer and Information Science},
volume = {1453},
pages = {1--10},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-981-16-7476-1\_1},
doi = {10.1007/978-981-16-7476-1\_1},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dmbd/WangGZLYWLL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ica3pp/YuCL21,
author = {Xi Yu and
Jianming Cui and
Ming Liu},
editor = {Yongxuan Lai and
Tian Wang and
Min Jiang and
Guangquan Xu and
Wei Liang and
Aniello Castiglione},
title = {An Embedding Carrier-Free Steganography Method Based on Wasserstein
{GAN}},
booktitle = {Algorithms and Architectures for Parallel Processing - 21st International
Conference, {ICA3PP} 2021, Virtual Event, December 3-5, 2021, Proceedings,
Part {II}},
series = {Lecture Notes in Computer Science},
volume = {13156},
pages = {532--545},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-95388-1\_35},
doi = {10.1007/978-3-030-95388-1\_35},
timestamp = {Thu, 03 Mar 2022 10:25:35 +0100},
biburl = {https://dblp.org/rec/conf/ica3pp/YuCL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccchina/LiuLLLX21,
author = {Shuduo Liu and
Jianghui Li and
Hanxiao Li and
Ming Liu and
Wen Xu},
title = {Degradation of {SNR} Imposed by Bubble Curtains in Underwater Acoustic
Channel},
booktitle = {10th {IEEE/CIC} International Conference on Communications in China,
{ICCC} Workshops 2021, Xiamen, China, July 28-30, 2021},
pages = {261--265},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICCCWorkshops52231.2021.9538852},
doi = {10.1109/ICCCWORKSHOPS52231.2021.9538852},
timestamp = {Sat, 25 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccchina/LiuLLLX21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icic/LiuLSZ21,
author = {Ming Liu and
Zhuohui Li and
Runyuan Sun and
Na Zhang},
editor = {De{-}Shuang Huang and
Kang{-}Hyun Jo and
Jianqiang Li and
Valeriya V. Gribova and
Abir Hussain},
title = {Predicting Course Score for Undergrade Students Using Neural Networks},
booktitle = {Intelligent Computing Theories and Application - 17th International
Conference, {ICIC} 2021, Shenzhen, China, August 12-15, 2021, Proceedings,
Part {II}},
series = {Lecture Notes in Computer Science},
volume = {12837},
pages = {732--744},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-84529-2\_61},
doi = {10.1007/978-3-030-84529-2\_61},
timestamp = {Mon, 16 Aug 2021 16:01:16 +0200},
biburl = {https://dblp.org/rec/conf/icic/LiuLSZ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/YangWML021,
author = {Bowen Yang and
Lorenz Wellhausen and
Takahiro Miki and
Ming Liu and
Marco Hutter},
title = {Real-time Optimal Navigation Planning Using Learned Motion Costs},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2021, Xi'an, China, May 30 - June 5, 2021},
pages = {9283--9289},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICRA48506.2021.9561861},
doi = {10.1109/ICRA48506.2021.9561861},
timestamp = {Sun, 12 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icra/YangWML021.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictai/LiuWGZLL21,
author = {Ming Liu and
Bo Wang and
Qiang Gao and
Li Zhang and
Xingchen Lin and
Bo Lang},
title = {Bridging Text Space and Knowledge Space via Transference Methods},
booktitle = {33rd {IEEE} International Conference on Tools with Artificial Intelligence,
{ICTAI} 2021, Washington, DC, USA, November 1-3, 2021},
pages = {959--964},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICTAI52525.2021.00153},
doi = {10.1109/ICTAI52525.2021.00153},
timestamp = {Tue, 28 Dec 2021 13:25:55 +0100},
biburl = {https://dblp.org/rec/conf/ictai/LiuWGZLL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieem/CenPOL21,
author = {Ling Cen and
Kin Poon and
Anis Ouali and
Ming Liu},
title = {Model Transformation for Automatic Design of {GPON/FTTH} Network},
booktitle = {{IEEE} International Conference on Industrial Engineering and Engineering
Management, {IEEM} 2021, Singapore, December 13-16, 2021},
pages = {1382--1386},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IEEM50564.2021.9672797},
doi = {10.1109/IEEM50564.2021.9672797},
timestamp = {Fri, 21 Jan 2022 14:04:48 +0100},
biburl = {https://dblp.org/rec/conf/ieem/CenPOL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ZhangYPL21,
author = {Xiaokang Zhang and
Weikang Yu and
Man{-}On Pun and
Ming Liu},
title = {Style Transformation-Based Change Detection Using Adversarial Learning
with Object Boundary Constraints},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2021, Brussels, Belgium, July 11-16, 2021},
pages = {3117--3120},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IGARSS47720.2021.9554645},
doi = {10.1109/IGARSS47720.2021.9554645},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/ZhangYPL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/YuZPL21,
author = {Weikang Yu and
Xiaokang Zhang and
Man{-}On Pun and
Ming Liu},
title = {A Hybrid Model-Based and Data-Driven Approach for Cloud Removal in
Satellite Imagery Using Multi-Scale Distortion-Aware Networks},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2021, Brussels, Belgium, July 11-16, 2021},
pages = {7160--7163},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IGARSS47720.2021.9554963},
doi = {10.1109/IGARSS47720.2021.9554963},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/YuZPL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/DuanWZWJLWZLDLL21,
author = {Zongming Duan and
Bowen Wu and
Chuanming Zhu and
Yan Wang and
Weiwei Jin and
Ying Liu and
Yanhui Wu and
Tao Zhang and
Ming Liu and
Bingfei Dou and
Bingbing Liao and
Wei Lv and
Dongfang Pan and
Yongjie Li and
Changwei Wang and
Yuefei Dai and
Pei Li and
Hao Gao},
title = {14.6 {A} 76-to-81GHz 2{\texttimes}8 {FMCW} {MIMO} Radar Transceiver
with Fast Chirp Generation and Multi-Feed Antenna-in-Package Array},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2021,
San Francisco, CA, USA, February 13-22, 2021},
pages = {228--230},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISSCC42613.2021.9365933},
doi = {10.1109/ISSCC42613.2021.9365933},
timestamp = {Thu, 21 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/DuanWZWJLWZLDLL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/PanLMDWYLC21,
author = {Dongfang Pan and
Guolong Li and
Fangting Miao and
Biao Deng and
Junying Wei and
Daquan Yu and
Ming Liu and
Lin Cheng},
title = {A 1.25W 46.5{\%}-Peak-Efficiency Transformer-in-Package Isolated {DC-DC}
Converter Using Glass-Based Fan-Out Wafer-Level Packaging Achieving
50mW/mm2 Power Density},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2021,
San Francisco, CA, USA, February 13-22, 2021},
pages = {468--470},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISSCC42613.2021.9365955},
doi = {10.1109/ISSCC42613.2021.9365955},
timestamp = {Sun, 23 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/PanLMDWYLC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ksem/LiuLWQS21,
author = {Ming Liu and
Jianxin Liao and
Jingyu Wang and
Qi Qi and
Haifeng Sun},
editor = {Han Qiu and
Cheng Zhang and
Zongming Fei and
Meikang Qiu and
Sun{-}Yuan Kung},
title = {Context-Aware Anomaly Detection in Attributed Networks},
booktitle = {Knowledge Science, Engineering and Management - 14th International
Conference, {KSEM} 2021, Tokyo, Japan, August 14-16, 2021, Proceedings,
Part {III}},
series = {Lecture Notes in Computer Science},
volume = {12817},
pages = {14--26},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-82153-1\_2},
doi = {10.1007/978-3-030-82153-1\_2},
timestamp = {Tue, 27 Sep 2022 13:33:22 +0200},
biburl = {https://dblp.org/rec/conf/ksem/LiuLWQS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/WangPLJZZHLRJ21,
author = {Chenying Wang and
Jiangtao Pu and
Lei Li and
Weixuan Jing and
Yijun Zhang and
Yaxin Zhang and
Feng Han and
Ming Liu and
Wei Ren and
Zhuangde Jiang},
title = {Effect of the Different Substrates and the Film Thickness on the Surface
Roughness of Step Structure},
booktitle = {16th {IEEE} International Conference on Nano/Micro Engineered and
Molecular Systems, {NEMS} 2021, Xiamen, China, April 25-29, 2021},
pages = {47--50},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/NEMS51815.2021.9451331},
doi = {10.1109/NEMS51815.2021.9451331},
timestamp = {Fri, 18 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nems/WangPLJZZHLRJ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trustcom/DengZXLCW21,
author = {Xianwen Deng and
Ruijie Zhao and
Zhi Xue and
Ming Liu and
Libo Chen and
Yijun Wang},
title = {A Semi-supervised Deep Learning-Based Solver for Breaking Text-Based
CAPTCHAs},
booktitle = {20th {IEEE} International Conference on Trust, Security and Privacy
in Computing and Communications, TrustCom 2021, Shenyang, China, October
20-22, 2021},
pages = {614--619},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/TrustCom53373.2021.00092},
doi = {10.1109/TRUSTCOM53373.2021.00092},
timestamp = {Mon, 30 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/trustcom/DengZXLCW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/ZhangHGXLZ21,
author = {Yixiao Zhang and
Rui Hao and
Bo Gao and
Zepeng Xie and
Ming Liu and
Tingting Zhang},
title = {A Collision-free Coordination Framework for Mixed-Vehicle Intersections},
booktitle = {94th {IEEE} Vehicular Technology Conference, {VTC} Fall 2021, Norman,
OK, USA, September 27-30, 2021},
pages = {1--6},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/VTC2021-Fall52928.2021.9625053},
doi = {10.1109/VTC2021-FALL52928.2021.9625053},
timestamp = {Tue, 05 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vtc/ZhangHGXLZ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-04921,
author = {Yuhang Yang and
Zilin Ding and
Xuan Cheng and
Xiaomin Wang and
Ming Liu},
title = {Self-supervised Feature Enhancement: Applying Internal Pretext Task
to Supervised Learning},
journal = {CoRR},
volume = {abs/2106.04921},
year = {2021},
url = {https://arxiv.org/abs/2106.04921},
eprinttype = {arXiv},
eprint = {2106.04921},
timestamp = {Tue, 15 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-04921.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-04922,
author = {Zilin Ding and
Yuhang Yang and
Xuan Cheng and
Xiaomin Wang and
Ming Liu},
title = {Self-supervision of Feature Transformation for Further Improving Supervised
Learning},
journal = {CoRR},
volume = {abs/2106.04922},
year = {2021},
url = {https://arxiv.org/abs/2106.04922},
eprinttype = {arXiv},
eprint = {2106.04922},
timestamp = {Tue, 15 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-04922.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-15316,
author = {Ming Liu and
Zhi Xue},
title = {A Fuzzy Post-project Evaluation Approach for Security Video Surveillance
System},
journal = {CoRR},
volume = {abs/2106.15316},
year = {2021},
url = {https://arxiv.org/abs/2106.15316},
eprinttype = {arXiv},
eprint = {2106.15316},
timestamp = {Mon, 05 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-15316.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-11821,
author = {Ming Liu and
Zhi Xue and
Xiangjian He and
Jinjun Chen},
title = {{SCADS:} {A} Scalable Approach Using Spark in Cloud for Host-based
Intrusion Detection System with System Calls},
journal = {CoRR},
volume = {abs/2109.11821},
year = {2021},
url = {https://arxiv.org/abs/2109.11821},
eprinttype = {arXiv},
eprint = {2109.11821},
timestamp = {Mon, 27 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-11821.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-14766,
author = {Ming Liu and
He Zhang and
Guanhao Wu},
title = {Fine Grained Human Evaluation for English-to-Chinese Machine Translation:
{A} Case Study on Scientific Text},
journal = {CoRR},
volume = {abs/2110.14766},
year = {2021},
url = {https://arxiv.org/abs/2110.14766},
eprinttype = {arXiv},
eprint = {2110.14766},
timestamp = {Tue, 02 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2110-14766.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-15270,
author = {Shaocong Wang and
Yi Li and
Dingchen Wang and
Woyu Zhang and
Xi Chen and
Danian Dong and
Songqi Wang and
Xumeng Zhang and
Peng Lin and
Claudio Gallicchio and
Xiaoxin Xu and
Qi Liu and
Kwang{-}Ting Cheng and
Zhongrui Wang and
Dashan Shang and
Ming Liu},
title = {Echo state graph neural networks with analogue random resistor arrays},
journal = {CoRR},
volume = {abs/2112.15270},
year = {2021},
url = {https://arxiv.org/abs/2112.15270},
eprinttype = {arXiv},
eprint = {2112.15270},
timestamp = {Wed, 05 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-15270.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/LiuLZZL20,
author = {Jinjin Liu and
Qingbao Li and
Ping Zhang and
Guimin Zhang and
Ming Liu},
title = {Unpaired Domain Transfer for Data Augment in Face Recognition},
journal = {{IEEE} Access},
volume = {8},
pages = {39349--39360},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.2976207},
doi = {10.1109/ACCESS.2020.2976207},
timestamp = {Thu, 19 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/LiuLZZL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ChenHHCLLLZC20,
author = {Xuhui Chen and
Huifang Hu and
Xiaoqing Huang and
Weiran Cai and
Ming Liu and
Chung Lam and
Xinnan Lin and
Lining Zhang and
Mansun Chan},
title = {A {SPICE} Model of Phase Change Memory for Neuromorphic Circuits},
journal = {{IEEE} Access},
volume = {8},
pages = {95278--95287},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.2995907},
doi = {10.1109/ACCESS.2020.2995907},
timestamp = {Tue, 16 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/ChenHHCLLLZC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/LiuLZL20,
author = {Ming Liu and
Jinjin Liu and
Ping Zhang and
Qingbao Li},
title = {{PA-GAN:} {A} Patch-Attention Based Aggregation Network for Face Recognition
in Surveillance},
journal = {{IEEE} Access},
volume = {8},
pages = {152780--152789},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.3017779},
doi = {10.1109/ACCESS.2020.3017779},
timestamp = {Sat, 19 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/LiuLZL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/LengXYSL20,
author = {Bo Leng and
Lu Xiong and
Zhuoping Yu and
Kai Sun and
Ming Liu},
title = {Robust Variable Structure Anti-Slip Control Method of a Distributed
Drive Electric Vehicle},
journal = {{IEEE} Access},
volume = {8},
pages = {162196--162208},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.3021694},
doi = {10.1109/ACCESS.2020.3021694},
timestamp = {Tue, 06 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/LengXYSL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/LiuLLW20,
author = {Jinjin Liu and
Qingbao Li and
Ming Liu and
Tongxin Wei},
title = {{CP-GAN:} {A} Cross-Pose Profile Face Frontalization Boosting Pose-Invariant
Face Recognition},
journal = {{IEEE} Access},
volume = {8},
pages = {198659--198667},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.3033675},
doi = {10.1109/ACCESS.2020.3033675},
timestamp = {Thu, 31 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/LiuLLW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/asc/RaoLGW20,
author = {Congjun Rao and
Ming Liu and
Mark Goh and
Jianghui Wen},
title = {2-stage modified random forest model for credit risk assessment of
{P2P} network lending to "Three Rurals" borrowers},
journal = {Appl. Soft Comput.},
volume = {95},
pages = {106570},
year = {2020},
url = {https://doi.org/10.1016/j.asoc.2020.106570},
doi = {10.1016/J.ASOC.2020.106570},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/asc/RaoLGW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aslib/DengLYL20,
author = {Weihua Deng and
Pei Lv and
Ming Yi and
Ming Liu},
title = {Understanding co-editing mechanism of wiki-based digital humanities
projects},
journal = {Aslib J. Inf. Manag.},
volume = {72},
number = {2},
pages = {199--218},
year = {2020},
url = {https://doi.org/10.1108/AJIM-08-2019-0214},
doi = {10.1108/AJIM-08-2019-0214},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aslib/DengLYL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/KongYXLWHGC20,
author = {Ren Kong and
Guangbo Yang and
Rui Xue and
Ming Liu and
Feng Wang and
Jianping Hu and
Xiaoqiang Guo and
Shan Chang},
title = {{COVID-19} Docking Server: a meta server for docking small molecules,
peptides and antibodies against potential targets of {COVID-19}},
journal = {Bioinform.},
volume = {36},
number = {20},
pages = {5109--5111},
year = {2020},
url = {https://doi.org/10.1093/bioinformatics/btaa645},
doi = {10.1093/BIOINFORMATICS/BTAA645},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/KongYXLWHGC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bspc/WangYLYXLL20,
author = {Ge Wang and
Lin Yang and
Ming Liu and
Xin Yuan and
Peng Xiong and
Feng Lin and
Xiu{-}Ling Liu},
title = {{ECG} signal denoising based on deep factor analysis},
journal = {Biomed. Signal Process. Control.},
volume = {57},
year = {2020},
url = {https://doi.org/10.1016/j.bspc.2019.101824},
doi = {10.1016/J.BSPC.2019.101824},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bspc/WangYLYXLL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cin/ShangHWYLL20,
author = {Shang Shang and
Kangning He and
Zhaobin Wang and
Tong Yang and
Ming Liu and
Xiang Li},
title = {Sea Clutter Suppression Method of {HFSWR} Based on {RBF} Neural Network
Model Optimized by Improved {GWO} Algorithm},
journal = {Comput. Intell. Neurosci.},
volume = {2020},
pages = {8842390:1--8842390:10},
year = {2020},
url = {https://doi.org/10.1155/2020/8842390},
doi = {10.1155/2020/8842390},
timestamp = {Tue, 28 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cin/ShangHWYLL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmmm/XuRGZPHLL20,
author = {Wenyi Xu and
Ping Ru and
Zhuorong Gu and
Ruoxi Zhang and
Xixia Pang and
Yi Huang and
Zhou Liu and
Ming Liu},
title = {Comprehensive Analysis of Differently Expressed and Methylated Genes
in Preeclampsia},
journal = {Comput. Math. Methods Medicine},
volume = {2020},
pages = {2139270:1--2139270:10},
year = {2020},
url = {https://doi.org/10.1155/2020/2139270},
doi = {10.1155/2020/2139270},
timestamp = {Sat, 25 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cmmm/XuRGZPHLL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/complexity/LuWWZHKCLW20,
author = {Yun Lu and
Mingjiang Wang and
Wanqing Wu and
Qiquan Zhang and
Yufei Han and
Tasleem Kausar and
Shixiong Chen and
Ming Liu and
Bo Wang},
title = {Entropy-Based Pattern Learning Based on Singular Spectrum Analysis
Components for Assessment of Physiological Signals},
journal = {Complex.},
volume = {2020},
pages = {4625218:1--4625218:17},
year = {2020},
url = {https://doi.org/10.1155/2020/4625218},
doi = {10.1155/2020/4625218},
timestamp = {Mon, 31 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/complexity/LuWWZHKCLW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbc/LiuMH20,
author = {Ming Liu and
Fanwei Meng and
Dongpo Hu},
title = {Impacts of Multiple Time Delays on a Gene Regulatory Network Mediated
by Small Noncoding {RNA}},
journal = {Int. J. Bifurc. Chaos},
volume = {30},
number = {5},
pages = {2050069:1--2050069:25},
year = {2020},
url = {https://doi.org/10.1142/S0218127420500698},
doi = {10.1142/S0218127420500698},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijbc/LiuMH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/LiuZLYDH20,
author = {Wenlong Liu and
Yuejin Zhao and
Ming Liu and
Weichao Yi and
Liquan Dong and
Mei Hui},
title = {Triple-adjacent-frame generative network for blind video motion deblurring},
journal = {Neurocomputing},
volume = {376},
pages = {153--165},
year = {2020},
url = {https://doi.org/10.1016/j.neucom.2019.09.031},
doi = {10.1016/J.NEUCOM.2019.09.031},
timestamp = {Wed, 15 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijon/LiuZLYDH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijspm/WangXPWHL20,
author = {Xue Wang and
Lili Xuan and
Ying Pan and
Haoying Wang and
Xiaochen Huang and
Ming Liu},
title = {Modelling and application of laparoscopic simulation system for panhysterectomy},
journal = {Int. J. Simul. Process. Model.},
volume = {15},
number = {1/2},
pages = {3--12},
year = {2020},
url = {https://doi.org/10.1504/IJSPM.2020.106964},
doi = {10.1504/IJSPM.2020.106964},
timestamp = {Thu, 16 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijspm/WangXPWHL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcb/HuXLWLW20,
author = {Maolin Hu and
Jiangling Xie and
Zhifeng Liu and
Xuan Wang and
Ming Liu and
Jianye Wang},
title = {Comprehensive Analysis Identifying Wnt Ligands Gene Family for Biochemical
Recurrence in Prostate Adenocarcinoma and Construction of a Nomogram},
journal = {J. Comput. Biol.},
volume = {27},
number = {12},
pages = {1656--1667},
year = {2020},
url = {https://doi.org/10.1089/cmb.2019.0397},
doi = {10.1089/CMB.2019.0397},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcb/HuXLWLW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jei/LinRLY20,
author = {Cunyi Lin and
Xianwei Rong and
Ming Liu and
Xiaoyan Yu},
title = {Attn-Eh {ALN:} complex text-to-image generation with attention-enhancing
adversarial learning networks},
journal = {J. Electronic Imaging},
volume = {29},
number = {6},
pages = {063014},
year = {2020},
url = {https://doi.org/10.1117/1.JEI.29.6.063014},
doi = {10.1117/1.JEI.29.6.063014},
timestamp = {Tue, 15 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jei/LinRLY20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmihi/ZhangLLQCZS20,
author = {Shuai Zhang and
Xipeng Liu and
Ming Liu and
Jianxin Qiao and
Bing Cao and
Xiufeng Zhang and
Daile Shi},
title = {Clinical Study of Multiple {MRI} Sequences for Resection of Craniocerebral
Tumors},
journal = {J. Medical Imaging Health Informatics},
volume = {10},
number = {2},
pages = {304--309},
year = {2020},
url = {https://doi.org/10.1166/jmihi.2020.2885},
doi = {10.1166/JMIHI.2020.2885},
timestamp = {Wed, 24 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jmihi/ZhangLLQCZS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jors/LiuXCZ20,
author = {Ming Liu and
Xifen Xu and
Jie Cao and
Ding Zhang},
title = {Integrated planning for public health emergencies: {A} modified model
for controlling {H1N1} pandemic},
journal = {J. Oper. Res. Soc.},
volume = {71},
number = {5},
pages = {748--761},
year = {2020},
url = {https://doi.org/10.1080/01605682.2019.1582589},
doi = {10.1080/01605682.2019.1582589},
timestamp = {Wed, 14 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jors/LiuXCZ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npl/XuXL20,
author = {Dongsheng Xu and
Chengqiang Xu and
Ming Liu},
title = {Graph-Theoretic Approach to Finite-Time Synchronization for Fuzzy
Cohen-Grossberg Neural Networks with Mixed Delays and Discontinuous
Activations},
journal = {Neural Process. Lett.},
volume = {52},
number = {1},
pages = {905--933},
year = {2020},
url = {https://doi.org/10.1007/s11063-020-10237-4},
doi = {10.1007/S11063-020-10237-4},
timestamp = {Wed, 26 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npl/XuXL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/ShaoTLSSQ20,
author = {Jinyuan Shao and
Lina Tang and
Ming Liu and
Guofan Shao and
Lang Sun and
Quanyi Qiu},
title = {BDD-Net: {A} General Protocol for Mapping Buildings Damaged by a Wide
Range of Disasters Based on Satellite Imagery},
journal = {Remote. Sens.},
volume = {12},
number = {10},
pages = {1670},
year = {2020},
url = {https://doi.org/10.3390/rs12101670},
doi = {10.3390/RS12101670},
timestamp = {Tue, 16 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/ShaoTLSSQ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/LvASYLX20,
author = {Xiaoran Lv and
Falk Amelung and
Yun Shao and
Shu Ye and
Ming Liu and
Chou Xie},
title = {Rheology of the Zagros Lithosphere from Post-Seismic Deformation of
the 2017 Mw7.3 Kermanshah, Iraq, Earthquake},
journal = {Remote. Sens.},
volume = {12},
number = {12},
pages = {2032},
year = {2020},
url = {https://doi.org/10.3390/rs12122032},
doi = {10.3390/RS12122032},
timestamp = {Mon, 13 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/LvASYLX20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/WeiJLLBJPL20,
author = {Shengrong Wei and
Weili Jiao and
Tengfei Long and
Huichan Liu and
Lu Bi and
Wei Jiang and
Boris A. Portnov and
Ming Liu},
title = {A Relative Radiation Normalization Method of {ISS} Nighttime Light
Images Based on Pseudo Invariant Features},
journal = {Remote. Sens.},
volume = {12},
number = {20},
pages = {3349},
year = {2020},
url = {https://doi.org/10.3390/rs12203349},
doi = {10.3390/RS12203349},
timestamp = {Thu, 16 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/WeiJLLBJPL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/soco/RaoLL20,
author = {Congjun Rao and
Hui Lin and
Ming Liu},
title = {Design of comprehensive evaluation index system for {P2P} credit risk
of "three rural" borrowers},
journal = {Soft Comput.},
volume = {24},
number = {15},
pages = {11493--11509},
year = {2020},
url = {https://doi.org/10.1007/s00500-019-04613-z},
doi = {10.1007/S00500-019-04613-Z},
timestamp = {Tue, 14 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/soco/RaoLL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/symmetry/ZhangL20,
author = {Xia Zhang and
Ming Liu},
title = {On Quantum Duality of Group Amenability},
journal = {Symmetry},
volume = {12},
number = {1},
pages = {85},
year = {2020},
url = {https://doi.org/10.3390/sym12010085},
doi = {10.3390/SYM12010085},
timestamp = {Tue, 03 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/symmetry/ZhangL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/LiLW0ZL20,
author = {Naihan Li and
Yanqing Liu and
Yu Wu and
Shujie Liu and
Sheng Zhao and
Ming Liu},
title = {RobuTrans: {A} Robust Transformer-Based Text-to-Speech Model},
booktitle = {The Thirty-Fourth {AAAI} Conference on Artificial Intelligence, {AAAI}
2020, The Thirty-Second Innovative Applications of Artificial Intelligence
Conference, {IAAI} 2020, The Tenth {AAAI} Symposium on Educational
Advances in Artificial Intelligence, {EAAI} 2020, New York, NY, USA,
February 7-12, 2020},
pages = {8228--8235},
publisher = {{AAAI} Press},
year = {2020},
url = {https://doi.org/10.1609/aaai.v34i05.6337},
doi = {10.1609/AAAI.V34I05.6337},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/LiLW0ZL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibm/LiuDPFP20,
author = {Ming Liu and
Wei Dai and
Wei Peng and
Yu Fu and
Yi Pan},
editor = {Taesung Park and
Young{-}Rae Cho and
Xiaohua Hu and
Illhoi Yoo and
Hyun Goo Woo and
Jianxin Wang and
Julio C. Facelli and
Seungyoon Nam and
Mingon Kang},
title = {A multi-view approach for predicting microbedisease associations by
fusing the linear and nonlinear features},
booktitle = {{IEEE} International Conference on Bioinformatics and Biomedicine,
{BIBM} 2020, Virtual Event, South Korea, December 16-19, 2020},
pages = {323--328},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/BIBM49941.2020.9313357},
doi = {10.1109/BIBM49941.2020.9313357},
timestamp = {Mon, 12 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bibm/LiuDPFP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csai/LiuCL20,
author = {Ming Liu and
Xin Chen and
Gang Liu},
title = {Font Generation Method based on U-net},
booktitle = {{CSAI} 2020: 2020 4th International Conference on Computer Science
and Artificial Intelligence, Zhuhai, China, December 11-13, 2020},
pages = {247--253},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3445815.3445855},
doi = {10.1145/3445815.3445855},
timestamp = {Wed, 31 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/csai/LiuCL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecai/LiuL00S20,
author = {Ming Liu and
Jianxin Liao and
Jingyu Wang and
Qi Qi and
Haifeng Sun},
editor = {Giuseppe De Giacomo and
Alejandro Catal{\'{a}} and
Bistra Dilkina and
Michela Milano and
Sen{\'{e}}n Barro and
Alberto Bugar{\'{\i}}n and
J{\'{e}}r{\^{o}}me Lang},
title = {Dual Attention-Based Adversarial Autoencoder for Attributed Network
Embedding},
booktitle = {{ECAI} 2020 - 24th European Conference on Artificial Intelligence,
29 August-8 September 2020, Santiago de Compostela, Spain, August
29 - September 8, 2020 - Including 10th Conference on Prestigious
Applications of Artificial Intelligence {(PAIS} 2020)},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {325},
pages = {521--528},
publisher = {{IOS} Press},
year = {2020},
url = {https://doi.org/10.3233/FAIA200134},
doi = {10.3233/FAIA200134},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ecai/LiuL00S20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icarm/LiuLZZWGW20,
author = {Ming Liu and
Mantian Li and
Fusheng Zha and
Fangwei Zou and
Pengfei Wang and
Wei Guo and
Haowei Wang},
title = {Stiffness Effect on Periodic Locomotion of Legged Robot Based on Dimensional
Analysis and Fixed Points Search Method},
booktitle = {5th International Conference on Advanced Robotics and Mechatronics,
{ICARM} 2020, Shenzhen, China, December 18-21, 2020},
pages = {103--106},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICARM49381.2020.9195276},
doi = {10.1109/ICARM49381.2020.9195276},
timestamp = {Tue, 22 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icarm/LiuLZZWGW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccsp/YangCZLL20,
author = {Zhongxin Yang and
Zhifeng Chen and
Ping Zhang and
Ming Liu and
Qingbao Li},
title = {An Information Intelligent Search Method for Computer Forensics Based
on Text Similarity},
booktitle = {{ICCSP} 2020: 4th International Conference on Cryptography, Security
and Privacy, Nanjing, China, January 10-12, 2020},
pages = {79--83},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3377644.3377659},
doi = {10.1145/3377644.3377659},
timestamp = {Thu, 30 Apr 2020 16:20:40 +0200},
biburl = {https://dblp.org/rec/conf/iccsp/YangCZLL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/Li0LZLZ20,
author = {Naihan Li and
Shujie Liu and
Yanqing Liu and
Sheng Zhao and
Ming Liu and
Ming Zhou},
editor = {Helen Meng and
Bo Xu and
Thomas Fang Zheng},
title = {MoBoAligner: {A} Neural Alignment Model for Non-Autoregressive {TTS}
with Monotonic Boundary Search},
booktitle = {Interspeech 2020, 21st Annual Conference of the International Speech
Communication Association, Virtual Event, Shanghai, China, 25-29 October
2020},
pages = {3999--4003},
publisher = {{ISCA}},
year = {2020},
url = {https://doi.org/10.21437/Interspeech.2020-1976},
doi = {10.21437/INTERSPEECH.2020-1976},
timestamp = {Fri, 09 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/Li0LZLZ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ksem/LiuSZCLL20,
author = {Sishun Liu and
Pengju Shuai and
Xiaowu Zhang and
Shuang Chen and
Li Li and
Ming Liu},
editor = {Gang Li and
Heng Tao Shen and
Ye Yuan and
Xiaoyang Wang and
Huawen Liu and
Xiang Zhao},
title = {Fine-Tuned Transformer Model for Sentiment Analysis},
booktitle = {Knowledge Science, Engineering and Management - 13th International
Conference, {KSEM} 2020, Hangzhou, China, August 28-30, 2020, Proceedings,
Part {II}},
series = {Lecture Notes in Computer Science},
volume = {12275},
pages = {336--343},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-55393-7\_30},
doi = {10.1007/978-3-030-55393-7\_30},
timestamp = {Mon, 07 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ksem/LiuSZCLL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lcn/GeTZlGL20,
author = {Fei Ge and
Liansheng Tan and
Wei Zhang and
Ming Liu and
Xun Gao and
Juan Luo},
editor = {Hwee{-}Pink Tan and
Lyes Khoukhi and
Sharief Oteafy},
title = {Transmission Scheduling and End-to-end Throughput of Multi-hop Paths
in Full-duplex Embedded Wireless Networks},
booktitle = {45th {IEEE} Conference on Local Computer Networks, {LCN} 2020, Sydney,
Australia, November 16-19, 2020},
pages = {325--328},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/LCN48667.2020.9314826},
doi = {10.1109/LCN48667.2020.9314826},
timestamp = {Sat, 06 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/lcn/GeTZlGL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/msn/MaCLNCL20,
author = {Lu Ma and
Weiling Chang and
Chao Li and
Shanjin Ni and
Jia Cui and
Ming Liu},
title = {Load balancing and resource management in distributed {B5G} networks},
booktitle = {16th International Conference on Mobility, Sensing and Networking,
{MSN} 2020, Tokyo, Japan, December 17-19, 2020},
pages = {268--274},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/MSN50589.2020.00053},
doi = {10.1109/MSN50589.2020.00053},
timestamp = {Wed, 14 Apr 2021 11:14:58 +0200},
biburl = {https://dblp.org/rec/conf/msn/MaCLNCL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/msn/LiuMLCWCJ20,
author = {Ming Liu and
Lu Ma and
Chao Li and
Weiling Chang and
Yuanjie Wang and
Jianming Cui and
Yingying Ji},
title = {Design and Analysis of Decentralized Interactive Cyber Defense Approach
based on Multi-agent Coordination},
booktitle = {16th International Conference on Mobility, Sensing and Networking,
{MSN} 2020, Tokyo, Japan, December 17-19, 2020},
pages = {659--664},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/MSN50589.2020.00110},
doi = {10.1109/MSN50589.2020.00110},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/msn/LiuMLCWCJ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/RouhaniLZLFOVMY20,
author = {Bita Darvish Rouhani and
Daniel Lo and
Ritchie Zhao and
Ming Liu and
Jeremy Fowers and
Kalin Ovtcharov and
Anna Vinogradsky and
Sarah Massengill and
Lita Yang and
Ray Bittner and
Alessandro Forin and
Haishan Zhu and
Taesik Na and
Prerak Patel and
Shuai Che and
Lok Chand Koppaka and
Xia Song and
Subhojit Som and
Kaustav Das and
Saurabh Tiwary and
Steven K. Reinhardt and
Sitaram Lanka and
Eric S. Chung and
Doug Burger},
editor = {Hugo Larochelle and
Marc'Aurelio Ranzato and
Raia Hadsell and
Maria{-}Florina Balcan and
Hsuan{-}Tien Lin},
title = {Pushing the Limits of Narrow Precision Inferencing at Cloud Scale
with Microsoft Floating Point},
booktitle = {Advances in Neural Information Processing Systems 33: Annual Conference
on Neural Information Processing Systems 2020, NeurIPS 2020, December
6-12, 2020, virtual},
year = {2020},
url = {https://proceedings.neurips.cc/paper/2020/hash/747e32ab0fea7fbd2ad9ec03daa3f840-Abstract.html},
timestamp = {Mon, 05 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/RouhaniLZLFOVMY20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ricai/ChengTLCFHCL20,
author = {Haotian Cheng and
Mulin Tong and
Ming Liu and
Ying Chang and
Longlong Feng and
Yueqiang Han and
Xiangyu Cheng and
Hao Liu},
title = {Gait data analysis based on acceleration sensor},
booktitle = {{RICAI} 2020: 2nd International Conference on Robotics, Intelligent
Control and Artificial Intelligence, Shanghai, China, October, 2020},
pages = {382--387},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3438872.3439111},
doi = {10.1145/3438872.3439111},
timestamp = {Fri, 03 Jun 2022 07:55:16 +0200},
biburl = {https://dblp.org/rec/conf/ricai/ChengTLCFHCL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-08528,
author = {Naihan Li and
Shujie Liu and
Yanqing Liu and
Sheng Zhao and
Ming Liu and
Ming Zhou},
title = {MoBoAligner: a Neural Alignment Model for Non-autoregressive {TTS}
with Monotonic Boundary Search},
journal = {CoRR},
volume = {abs/2005.08528},
year = {2020},
url = {https://arxiv.org/abs/2005.08528},
eprinttype = {arXiv},
eprint = {2005.08528},
timestamp = {Fri, 09 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2005-08528.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-02742,
author = {Subba Reddy Oota and
Nafisur Rahman and
Shahid Saleem Mohammed and
Jeffrey Galitz and
Ming Liu},
title = {Wound and episode level readmission risk or weeks to readmit: Why
do patients get readmitted? How long does it take for a patient to
get readmitted?},
journal = {CoRR},
volume = {abs/2010.02742},
year = {2020},
url = {https://arxiv.org/abs/2010.02742},
eprinttype = {arXiv},
eprint = {2010.02742},
timestamp = {Mon, 12 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-02742.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ZhangLXDZLHL19,
author = {Jieshuo Zhang and
Feng Lin and
Peng Xiong and
Haiman Du and
Hong Zhang and
Ming Liu and
Zengguang Hou and
Xiu{-}Ling Liu},
title = {Automated Detection and Localization of Myocardial Infarction With
Staked Sparse Autoencoder and TreeBagger},
journal = {{IEEE} Access},
volume = {7},
pages = {70634--70642},
year = {2019},
url = {https://doi.org/10.1109/ACCESS.2019.2919068},
doi = {10.1109/ACCESS.2019.2919068},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/ZhangLXDZLHL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/LiuJW19,
author = {Ming Liu and
Jue Jiang and
Zenan Wang},
title = {Colonic Polyp Detection in Endoscopic Videos With Single Shot Detection
Based Deep Convolutional Neural Network},
journal = {{IEEE} Access},
volume = {7},
pages = {75058--75066},
year = {2019},
url = {https://doi.org/10.1109/ACCESS.2019.2921027},
doi = {10.1109/ACCESS.2019.2921027},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/LiuJW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcmi/CaoLZLBLC19,
author = {Xiaohui Cao and
Ming Liu and
Fushan Zhai and
Nan Li and
Chaoen Bao and
Yinliang Liu and
Gang Chen},
title = {Comparison of different registration methods and landmarks for image-guided
radiation therapy of pulmonary tumors},
journal = {{BMC} Medical Imaging},
volume = {19},
number = {1},
pages = {46:1--46:6},
year = {2019},
url = {https://doi.org/10.1186/s12880-019-0343-3},
doi = {10.1186/S12880-019-0343-3},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcmi/CaoLZLBLC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcmi/CaoLZLLBLC19,
author = {Xiaohui Cao and
Ming Liu and
Fushan Zhai and
Nan Li and
Feng Lin and
Chaoen Bao and
Yinliang Liu and
Gang Chen},
title = {Comparative evaluation of image registration methods with different
interest regions in lung cancer radiotherapy},
journal = {{BMC} Medical Imaging},
volume = {19},
number = {1},
pages = {100},
year = {2019},
url = {https://doi.org/10.1186/s12880-019-0402-9},
doi = {10.1186/S12880-019-0402-9},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcmi/CaoLZLLBLC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/brain/ZhangGLLCWGJHL19,
author = {Delong Zhang and
Zhenni Gao and
Bishan Liang and
Junchao Li and
Yuxuan Cai and
Zengjian Wang and
Mengxia Gao and
Bingqing Jiao and
Ruiwang Huang and
Ming Liu},
title = {Eyes Closed Elevates Brain Intrinsic Activity of Sensory Dominance
Networks: {A} Classifier Discrimination Analysis},
journal = {Brain Connect.},
volume = {9},
number = {2},
pages = {221--230},
year = {2019},
url = {https://doi.org/10.1089/brain.2018.0644},
doi = {10.1089/BRAIN.2018.0644},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/brain/ZhangGLLCWGJHL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eaai/HaoLXDZLHL19,
author = {Huaqing Hao and
Ming Liu and
Peng Xiong and
Haiman Du and
Hong Zhang and
Feng Lin and
Zengguang Hou and
Xiu{-}Ling Liu},
title = {Multi-lead model-based {ECG} signal denoising by guided filter},
journal = {Eng. Appl. Artif. Intell.},
volume = {79},
pages = {34--44},
year = {2019},
url = {https://doi.org/10.1016/j.engappai.2018.12.004},
doi = {10.1016/J.ENGAPPAI.2018.12.004},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eaai/HaoLXDZLHL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejwcn/YangZLZ19,
author = {Qing Yang and
Shijue Zheng and
Ming Liu and
Yawen Zhang},
title = {Research on Wi-Fi indoor positioning in a smart exhibition hall based
on received signal strength indication},
journal = {{EURASIP} J. Wirel. Commun. Netw.},
volume = {2019},
pages = {275},
year = {2019},
url = {https://doi.org/10.1186/s13638-019-1601-3},
doi = {10.1186/S13638-019-1601-3},
timestamp = {Wed, 11 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ejwcn/YangZLZ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/finr/LiuWCZCWWX20,
author = {Ming Liu and
Kangning Wang and
Xiaogang Chen and
Jing Zhao and
Yuanyuan Chen and
Huiquan Wang and
Jinhai Wang and
Shengpu Xu},
title = {Indoor Simulated Training Environment for Brain-Controlled Wheelchair
Based on Steady-State Visual Evoked Potentials},
journal = {Frontiers Neurorobotics},
volume = {13},
pages = {101},
year = {2019},
url = {https://doi.org/10.3389/fnbot.2019.00101},
doi = {10.3389/FNBOT.2019.00101},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/finr/LiuWCZCWWX20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijiids/GuoLLZ19,
author = {Jinglei Guo and
Wei Liu and
Ming Liu and
Shijue Zheng},
title = {Hybrid fireworks algorithm with differential evolution operator},
journal = {Int. J. Intell. Inf. Database Syst.},
volume = {12},
number = {1/2},
pages = {47--64},
year = {2019},
url = {https://doi.org/10.1504/IJIIDS.2019.102326},
doi = {10.1504/IJIIDS.2019.102326},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijiids/GuoLLZ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/itor/LiuXZ19,
author = {Ming Liu and
Xifen Xu and
Ding Zhang},
title = {Integrated optimization model for distribution network design: a case
study of the clothing industry},
journal = {Int. Trans. Oper. Res.},
volume = {26},
number = {4},
pages = {1269--1292},
year = {2019},
url = {https://doi.org/10.1111/itor.12628},
doi = {10.1111/ITOR.12628},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/itor/LiuXZ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jifs/LiuZXM19,
author = {Ming Liu and
Hua Zhao and
Zeshui Xu and
Rufei Ma},
title = {Simplified interval-valued intuitionistic multiplicative numbers in
uncertain group decision making},
journal = {J. Intell. Fuzzy Syst.},
volume = {37},
number = {3},
pages = {3879--3895},
year = {2019},
url = {https://doi.org/10.3233/JIFS-190127},
doi = {10.3233/JIFS-190127},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jifs/LiuZXM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/LiuLLY19,
author = {Hongyu Liu and
Bo Lang and
Ming Liu and
Hanbing Yan},
title = {{CNN} and {RNN} based payload classification methods for attack detection},
journal = {Knowl. Based Syst.},
volume = {163},
pages = {332--341},
year = {2019},
url = {https://doi.org/10.1016/j.knosys.2018.08.036},
doi = {10.1016/J.KNOSYS.2018.08.036},
timestamp = {Tue, 25 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/kbs/LiuLLY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/FowersOPMLLAHAG19,
author = {Jeremy Fowers and
Kalin Ovtcharov and
Michael K. Papamichael and
Todd Massengill and
Ming Liu and
Daniel Lo and
Shlomi Alkalay and
Michael Haselman and
Logan Adams and
Mahdi Ghandi and
Stephen Heil and
Prerak Patel and
Adam Sapek and
Gabriel Weisz and
Lisa Woods and
Sitaram Lanka and
Steven K. Reinhardt and
Adrian M. Caulfield and
Eric S. Chung and
Doug Burger},
title = {Inside Project Brainwave's Cloud-Scale, Real-Time {AI} Processor},
journal = {{IEEE} Micro},
volume = {39},
number = {3},
pages = {20--28},
year = {2019},
url = {https://doi.org/10.1109/MM.2019.2910506},
doi = {10.1109/MM.2019.2910506},
timestamp = {Thu, 16 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/FowersOPMLLAHAG19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/DongDLZLFLHKH19,
author = {Liquan Dong and
Haoyuan Du and
Ming Liu and
Yuejin Zhao and
Xueyan Li and
Shijia Feng and
Xiaohua Liu and
Mei Hui and
Lingqin Kong and
Qun Hao},
title = {Extended-depth-of-field object detection with wavefront coding imaging
system},
journal = {Pattern Recognit. Lett.},
volume = {125},
pages = {597--603},
year = {2019},
url = {https://doi.org/10.1016/j.patrec.2019.06.011},
doi = {10.1016/J.PATREC.2019.06.011},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/prl/DongDLZLFLHKH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/ZhouLL19,
author = {Gaoxiang Zhou and
Xiangnan Liu and
Ming Liu},
title = {Assimilating Remote Sensing Phenological Information into the {WOFOST}
Model for Rice Growth Simulation},
journal = {Remote. Sens.},
volume = {11},
number = {3},
pages = {268},
year = {2019},
url = {https://doi.org/10.3390/rs11030268},
doi = {10.3390/RS11030268},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/remotesensing/ZhouLL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scl/GaoLSLW19,
author = {Yabin Gao and
Jianxing Liu and
Guanghui Sun and
Ming Liu and
Ligang Wu},
title = {Fault deviation estimation and integral sliding mode control design
for Lipschitz nonlinear systems},
journal = {Syst. Control. Lett.},
volume = {123},
pages = {8--15},
year = {2019},
url = {https://doi.org/10.1016/j.sysconle.2018.08.006},
doi = {10.1016/J.SYSCONLE.2018.08.006},
timestamp = {Wed, 13 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/scl/GaoLSLW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/BaiLLXLH19,
author = {Shiyu Bai and
Jizhou Lai and
Pin Lyu and
Xiaowei Xu and
Ming Liu and
Kai Huang},
title = {A System-Level Self-Calibration Method for Installation Errors in
{A} Dual-Axis Rotational Inertial Navigation System},
journal = {Sensors},
volume = {19},
number = {18},
pages = {4005},
year = {2019},
url = {https://doi.org/10.3390/s19184005},
doi = {10.3390/S19184005},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/BaiLLXLH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/LiLGSZLCMG19,
author = {Dan Li and
Ming Liu and
Shengwei Gao and
Yongjun Shi and
Yihua Zhang and
Zhiyong Li and
Patrick Yin Chiang and
Franco Maloberti and
Li Geng},
title = {Low-Noise Broadband {CMOS} {TIA} Based on Multi-Stage Stagger-Tuned
Amplifier for High-Speed High-Sensitivity Optical Communication},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {66-I},
number = {10},
pages = {3676--3689},
year = {2019},
url = {https://doi.org/10.1109/TCSI.2019.2916150},
doi = {10.1109/TCSI.2019.2916150},
timestamp = {Thu, 01 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/LiLGSZLCMG19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/LiuHLZLZ19,
author = {Shuaiqi Liu and
Qi Hu and
Pengfei Li and
Jie Zhao and
Ming Liu and
Zhihui Zhu},
title = {Speckle Suppression Based on Weighted Nuclear Norm Minimization and
Grey Theory},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {57},
number = {5},
pages = {2700--2708},
year = {2019},
url = {https://doi.org/10.1109/TGRS.2018.2876339},
doi = {10.1109/TGRS.2018.2876339},
timestamp = {Tue, 28 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/LiuHLZLZ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wpc/ChenLF19,
author = {Hongsong Chen and
Ming Liu and
Zhongchuan Fu},
title = {Using Improved Hilbert-Huang Transformation Method to Detect Routing-Layer
Reduce of Quality Attack in Wireless Sensor Network},
journal = {Wirel. Pers. Commun.},
volume = {104},
number = {2},
pages = {595--615},
year = {2019},
url = {https://doi.org/10.1007/s11277-018-6036-3},
doi = {10.1007/S11277-018-6036-3},
timestamp = {Thu, 20 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/wpc/ChenLF19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/Li0LZL19,
author = {Naihan Li and
Shujie Liu and
Yanqing Liu and
Sheng Zhao and
Ming Liu},
title = {Neural Speech Synthesis with Transformer Network},
booktitle = {The Thirty-Third {AAAI} Conference on Artificial Intelligence, {AAAI}
2019, The Thirty-First Innovative Applications of Artificial Intelligence
Conference, {IAAI} 2019, The Ninth {AAAI} Symposium on Educational
Advances in Artificial Intelligence, {EAAI} 2019, Honolulu, Hawaii,
USA, January 27 - February 1, 2019},
pages = {6706--6713},
publisher = {{AAAI} Press},
year = {2019},
url = {https://doi.org/10.1609/aaai.v33i01.33016706},
doi = {10.1609/AAAI.V33I01.33016706},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/Li0LZL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apsipa/LiuWYWX19,
author = {Ming Liu and
Yujun Wang and
Zhaoyu Yan and
Jing Wang and
Xiang Xie},
title = {Robust Speech Recognition based on Multi-Objective Learning with {GRU}
Network},
booktitle = {2019 Asia-Pacific Signal and Information Processing Association Annual
Summit and Conference, {APSIPA} {ASC} 2019, Lanzhou, China, November
18-21, 2019},
pages = {181--185},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/APSIPAASC47483.2019.9023325},
doi = {10.1109/APSIPAASC47483.2019.9023325},
timestamp = {Thu, 12 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/apsipa/LiuWYWX19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/DuSWQLXL19,
author = {Chunning Du and
Haifeng Sun and
Jingyu Wang and
Qi Qi and
Jianxin Liao and
Tong Xu and
Ming Liu},
editor = {Kentaro Inui and
Jing Jiang and
Vincent Ng and
Xiaojun Wan},
title = {Capsule Network with Interactive Attention for Aspect-Level Sentiment
Classification},
booktitle = {Proceedings of the 2019 Conference on Empirical Methods in Natural
Language Processing and the 9th International Joint Conference on
Natural Language Processing, {EMNLP-IJCNLP} 2019, Hong Kong, China,
November 3-7, 2019},
pages = {5488--5497},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/D19-1551},
doi = {10.18653/V1/D19-1551},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/DuSWQLXL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/LiuLW019,
author = {Ming Liu and
Jianxin Liao and
Jingyu Wang and
Qi Qi},
title = {{AGRM:} Attention-Based Graph Representation Model for Telecom Fraud
Detection},
booktitle = {2019 {IEEE} International Conference on Communications, {ICC} 2019,
Shanghai, China, May 20-24, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICC.2019.8761665},
doi = {10.1109/ICC.2019.8761665},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icc/LiuLW019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccse2/QinLY19,
author = {Xiaoli Qin and
Ming Liu and
Ming Yang},
title = {Research on Navigation Based on Target Maneuver},
booktitle = {14th International Conference on Computer Science {\&} Education,
{ICCSE} 2019, Toronto, ON, Canada, August 19-21, 2019},
pages = {878--882},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICCSE.2019.8845335},
doi = {10.1109/ICCSE.2019.8845335},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iccse2/QinLY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icira/LiuDTYZ19,
author = {Ming Liu and
Na Dong and
Qimeng Tan and
Bixi Yan and
Jingyi Zhao},
editor = {Haibin Yu and
Jinguo Liu and
Lianqing Liu and
Zhaojie Ju and
Yuwang Liu and
Dalin Zhou},
title = {Research on Autonomous Face Recognition System for Spatial Human-Robotic
Interaction Based on Deep Learning},
booktitle = {Intelligent Robotics and Applications - 12th International Conference,
{ICIRA} 2019, Shenyang, China, August 8-11, 2019, Proceedings, Part
{V}},
series = {Lecture Notes in Computer Science},
volume = {11744},
pages = {131--141},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-27541-9\_12},
doi = {10.1007/978-3-030-27541-9\_12},
timestamp = {Sat, 19 Oct 2019 20:15:42 +0200},
biburl = {https://dblp.org/rec/conf/icira/LiuDTYZ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmssp/0004WWZHL19,
author = {Yun Lu and
Mingjiang Wang and
Wanqing Wu and
Qiquan Zhang and
Yufei Han and
Ming Liu},
title = {Identification of Emotional Valences via Memory-Informed Deep Neural
Network with Entropy Features},
booktitle = {Proceedings of the 4th International Conference on Multimedia Systems
and Signal Processing, {ICMSSP} 2019, Guangzhou, China, May 10-12,
2019},
pages = {31--35},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3330393.3330408},
doi = {10.1145/3330393.3330408},
timestamp = {Tue, 26 Sep 2023 10:38:37 +0200},
biburl = {https://dblp.org/rec/conf/icmssp/0004WWZHL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icvip/LiuZLLC19,
author = {Ming Liu and
Ping Zhang and
Qingbao Li and
Jinjin Liu and
Zhifeng Chen},
title = {{LEFV:} {A} Lightweight and Efficient System for Face Verification
with Deep Convolution Neural Networks},
booktitle = {{ICVIP} 2019: The 3rd International Conference on Video and Image
Processing, Shanghai, China, December 20-23, 2019},
pages = {222--227},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3376067.3376077},
doi = {10.1145/3376067.3376077},
timestamp = {Fri, 20 Mar 2020 15:46:40 +0100},
biburl = {https://dblp.org/rec/conf/icvip/LiuZLLC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/LiuZSL19,
author = {Ming Liu and
Gaoxiang Zhou and
Rebecca K. Saari and
Jonathan Li},
title = {Long-Term Trend of Ground-Level {PM2.5} Concentrations Over 2012-2017
in China},
booktitle = {2019 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2019, Yokohama, Japan, July 28 - August 2, 2019},
pages = {7842--7845},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/IGARSS.2019.8900405},
doi = {10.1109/IGARSS.2019.8900405},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/LiuZSL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/DingLLJZWW19,
author = {Yi Ding and
Ming Liu and
Suju Li and
Dan Jia and
Lei Zhou and
Bin Wu and
Yani Wang},
title = {Mountainous Landslide Recognition Based on Gaofen-3 Polarimetric {SAR}
Imagery},
booktitle = {2019 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2019, Yokohama, Japan, July 28 - August 2, 2019},
pages = {9634--9637},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/IGARSS.2019.8900478},
doi = {10.1109/IGARSS.2019.8900478},
timestamp = {Sat, 23 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/DingLLJZWW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/WuLJLCWZYZ19,
author = {Bin Wu and
Ming Liu and
Dan Jia and
Suju Li and
Qiang Cong and
Chao Wang and
Yang Zhu and
Huan Yin and
Jun Zhu},
title = {A Method of Automatically Extracting Forest Fire Burned Areas Using
Gf-1 Remote Sensing Images},
booktitle = {2019 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2019, Yokohama, Japan, July 28 - August 2, 2019},
pages = {9953--9955},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/IGARSS.2019.8900399},
doi = {10.1109/IGARSS.2019.8900399},
timestamp = {Sun, 24 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/WuLJLCWZYZ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscid/ChengL19,
author = {Miao Cheng and
Ming Liu},
title = {Bottom-up simplied RefineNet for human clothing estimation},
booktitle = {12th International Symposium on Computational Intelligence and Design,
{ISCID} 2019, Hangzhou, China, December 14-15, 2019, Volume 1},
pages = {192--197},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISCID.2019.00051},
doi = {10.1109/ISCID.2019.00051},
timestamp = {Mon, 08 Jun 2020 15:58:13 +0200},
biburl = {https://dblp.org/rec/conf/iscid/ChengL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispa/XieXWLLL19,
author = {Huosheng Xie and
Wei Xie and
Lidong Wu and
Qing Lin and
Ming Liu and
Yongjing Lin},
title = {Prediction of Short-Imminent Heavy Rainfall Based on {ECMWF} Model},
booktitle = {2019 {IEEE} Intl Conf on Parallel {\&} Distributed Processing
with Applications, Big Data {\&} Cloud Computing, Sustainable
Computing {\&} Communications, Social Computing {\&} Networking,
ISPA/BDCloud/SocialCom/SustainCom 2019, Xiamen, China, December 16-18,
2019},
pages = {1340--1345},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISPA-BDCloud-SustainCom-SocialCom48970.2019.00192},
doi = {10.1109/ISPA-BDCLOUD-SUSTAINCOM-SOCIALCOM48970.2019.00192},
timestamp = {Fri, 03 Apr 2020 09:58:46 +0200},
biburl = {https://dblp.org/rec/conf/ispa/XieXWLLL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mobicom/GeTGLZL19,
author = {Fei Ge and
Liansheng Tan and
Xun Gao and
Juan Luo and
Wei Zhang and
Ming Liu},
editor = {Stephen A. Brewster and
Geraldine Fitzpatrick and
Anna L. Cox and
Vassilis Kostakos},
title = {Poster: Enhancing Capacity in Multi-hop Wireless Networks by Joint
Node Units},
booktitle = {The 25th Annual International Conference on Mobile Computing and Networking,
MobiCom 2019, Los Cabos, Mexico, October 21-25, 2019},
pages = {86:1--86:3},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3300061.3343390},
doi = {10.1145/3300061.3343390},
timestamp = {Wed, 30 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mobicom/GeTGLZL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/spml/LiuZZ19,
author = {Ming Liu and
Caiming Zhang and
Zhao Zhang},
title = {Multi-Scale Deep Convolutional Nets with Attention Model and Conditional
Random Fields for Semantic Image Segmentation},
booktitle = {2nd International Conference on Signal Processing and Machine Learning,
{SPML} 2019, Hangzhou, China, November, 27-29, 2019},
pages = {73--78},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3372806.3372811},
doi = {10.1145/3372806.3372811},
timestamp = {Thu, 23 Jan 2020 16:32:27 +0100},
biburl = {https://dblp.org/rec/conf/spml/LiuZZ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1910-06001,
author = {Xinle Liang and
Yang Liu and
Tianjian Chen and
Ming Liu and
Qiang Yang},
title = {Federated Transfer Reinforcement Learning for Autonomous Driving},
journal = {CoRR},
volume = {abs/1910.06001},
year = {2019},
url = {http://arxiv.org/abs/1910.06001},
eprinttype = {arXiv},
eprint = {1910.06001},
timestamp = {Thu, 27 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1910-06001.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1911-05797,
author = {Evaristo Cisbani and
Alessio Del Dotto and
Cristiano Fanelli and
Michael Williams and
M. Alfred and
Fernando Barbosa and
Luca Barion and
Vladimir Berdnikov and
William Brooks and
Tongtong Cao and
Marco Contalbrigo and
Samuel Danagoulian and
A. Datta and
Marcellinus Demarteau and
A. Denisov and
Markus Diefenthaler and
A. Durum and
D. Fields and
Yulia Furletova and
Colin Gleason and
Matthias Grosse{-}Perdekamp and
Mohammad Hattawy and
Xu{-}Gang He and
Hubert van Hecke and
Douglas Higinbotham and
Tanja Horn and
Charles Hyde and
Yordanka Ilieva and
Grzegorz Kalicy and
A. Kebede and
B. Kim and
Ming Liu and
J. McKisson and
Rodrigo Mendez and
Pawel Nadel{-}Turonski and
Ian Pegg and
Dmitry Romanov and
Murad Sarsour and
C. L. da Silva and
J. Stevens and
Xu Sun and
S. Syed and
Rusty Towell and
Junqi Xie and
Zhiwen Zhao and
Benedikt Zihlmann and
Carl Zorn},
title = {AI-optimized detector design for the future Electron-Ion Collider:
the dual-radiator {RICH} case},
journal = {CoRR},
volume = {abs/1911.05797},
year = {2019},
url = {http://arxiv.org/abs/1911.05797},
eprinttype = {arXiv},
eprint = {1911.05797},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1911-05797.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1912-11196,
author = {Jiajun Xian and
Dan Yang and
Liming Pan and
Ming Liu and
Wei Wang},
title = {Containing rumors spreading on correlated multiplex networks},
journal = {CoRR},
volume = {abs/1912.11196},
year = {2019},
url = {http://arxiv.org/abs/1912.11196},
eprinttype = {arXiv},
eprint = {1912.11196},
timestamp = {Tue, 07 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1912-11196.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ChengLLWBL18,
author = {Tinghai Cheng and
Wenbo Liu and
Xiaohui Lu and
Yingting Wang and
Gang Bao and
Ming Liu},
title = {A Small Magnetic Pre-Stress Based Piezoelectric Diaphragm Generator
Induced By Hyperbaric Air},
journal = {{IEEE} Access},
volume = {6},
pages = {26596--26604},
year = {2018},
url = {https://doi.org/10.1109/ACCESS.2018.2817265},
doi = {10.1109/ACCESS.2018.2817265},
timestamp = {Tue, 09 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/ChengLLWBL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dsp/HanWL18,
author = {Yufei Han and
Mingjiang Wang and
Ming Liu},
title = {An improved variable tap-length algorithm with adaptive parameters},
journal = {Digit. Signal Process.},
volume = {74},
pages = {111--118},
year = {2018},
url = {https://doi.org/10.1016/j.dsp.2017.12.005},
doi = {10.1016/J.DSP.2017.12.005},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dsp/HanWL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/hisas/TanGHWLL18,
author = {Wenjun Tan and
Wen Ge and
Yucheng Hang and
Simeng Wu and
Sixing Liu and
Ming Liu},
title = {Computer assisted system for precise lung surgery based on medical
image computing and mixed reality},
journal = {Health Inf. Sci. Syst.},
volume = {6},
number = {1},
pages = {10},
year = {2018},
url = {https://doi.org/10.1007/s13755-018-0053-1},
doi = {10.1007/S13755-018-0053-1},
timestamp = {Tue, 16 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/hisas/TanGHWLL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/WangZL18,
author = {Mingjiang Wang and
Boya Zhao and
Ming Liu},
title = {A high-speed realization of the delayed dual sign {LMS} algorithm},
journal = {{IEICE} Electron. Express},
volume = {15},
number = {7},
pages = {20180116},
year = {2018},
url = {https://doi.org/10.1587/elex.15.20180116},
doi = {10.1587/ELEX.15.20180116},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieiceee/WangZL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/LuZL18a,
author = {Xingguo Lu and
Yue Zhao and
Ming Liu},
title = {Self-learning interval type-2 fuzzy neural network controllers for
trajectory control of a Delta parallel robot},
journal = {Neurocomputing},
volume = {283},
pages = {107--119},
year = {2018},
url = {https://doi.org/10.1016/j.neucom.2017.12.043},
doi = {10.1016/J.NEUCOM.2017.12.043},
timestamp = {Thu, 18 Apr 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/LuZL18a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/ChungFOPCMLLAHA18,
author = {Eric S. Chung and
Jeremy Fowers and
Kalin Ovtcharov and
Michael Papamichael and
Adrian M. Caulfield and
Todd Massengill and
Ming Liu and
Daniel Lo and
Shlomi Alkalay and
Michael Haselman and
Maleen Abeydeera and
Logan Adams and
Hari Angepat and
Christian Boehn and
Derek Chiou and
Oren Firestein and
Alessandro Forin and
Kang Su Gatlin and
Mahdi Ghandi and
Stephen Heil and
Kyle Holohan and
Ahmad El Husseini and
Tam{\'{a}}s Juh{\'{a}}sz and
Kara Kagi and
Ratna Kovvuri and
Sitaram Lanka and
Friedel van Megen and
Dima Mukhortov and
Prerak Patel and
Brandon Perez and
Amanda Rapsang and
Steven K. Reinhardt and
Bita Rouhani and
Adam Sapek and
Raja Seera and
Sangeetha Shekar and
Balaji Sridharan and
Gabriel Weisz and
Lisa Woods and
Phillip Yi Xiao and
Dan Zhang and
Ritchie Zhao and
Doug Burger},
title = {Serving DNNs in Real Time at Datacenter Scale with Project Brainwave},
journal = {{IEEE} Micro},
volume = {38},
number = {2},
pages = {8--20},
year = {2018},
url = {https://doi.org/10.1109/MM.2018.022071131},
doi = {10.1109/MM.2018.022071131},
timestamp = {Fri, 11 May 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/ChungFOPCMLLAHA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mlc/YangBLLHL18,
author = {Jianli Yang and
Yang Bai and
Feng Lin and
Ming Liu and
Zengguang Hou and
Xiu{-}Ling Liu},
title = {A novel electrocardiogram arrhythmia classification method based on
stacked sparse auto-encoders and softmax regression},
journal = {Int. J. Mach. Learn. Cybern.},
volume = {9},
number = {10},
pages = {1733--1740},
year = {2018},
url = {https://doi.org/10.1007/s13042-017-0677-5},
doi = {10.1007/S13042-017-0677-5},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mlc/YangBLLHL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/PuJXCLX18,
author = {Jiangbo Pu and
Youcong Jiang and
Xiaobo Xie and
Xiaogang Chen and
Ming Liu and
Shengpu Xu},
title = {Low cost sensor network for obstacle avoidance in share-controlled
smart wheelchairs under daily scenarios},
journal = {Microelectron. Reliab.},
volume = {83},
pages = {180--186},
year = {2018},
url = {https://doi.org/10.1016/j.microrel.2018.03.003},
doi = {10.1016/J.MICROREL.2018.03.003},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mr/PuJXCLX18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LiuRSLZLYJTJ18,
author = {Yantao Liu and
Wei Ren and
Peng Shi and
Dan Liu and
Yijun Zhang and
Ming Liu and
Zuo{-}Guang Ye and
Weixuan Jing and
Bian Tian and
Zhuangde Jiang},
title = {A Highly Thermostable In\({}_{\mbox{2}}\)O\({}_{\mbox{3}}\)/ITO Thin
Film Thermocouple Prepared via Screen Printing for High Temperature
Measurements},
journal = {Sensors},
volume = {18},
number = {4},
pages = {958},
year = {2018},
url = {https://doi.org/10.3390/s18040958},
doi = {10.3390/S18040958},
timestamp = {Mon, 09 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/LiuRSLZLYJTJ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/ChengLZLLL18,
author = {Xiang Cheng and
Qingquan Li and
Zhiwei Zhou and
Zhixiang Luo and
Ming Liu and
Lu Liu},
title = {Research on a Seepage Monitoring Model of a High Core Rockfill Dam
Based on Machine Learning},
journal = {Sensors},
volume = {18},
number = {9},
pages = {2749},
year = {2018},
url = {https://doi.org/10.3390/s18092749},
doi = {10.3390/S18092749},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/ChengLZLLL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/soco/MaLHGLZ18,
author = {Xiaole Ma and
Shuaiqi Liu and
Shaohai Hu and
Peng Geng and
Ming Liu and
Jie Zhao},
title = {{SAR} image edge detection via sparse representation},
journal = {Soft Comput.},
volume = {22},
number = {8},
pages = {2507--2515},
year = {2018},
url = {https://doi.org/10.1007/s00500-017-2505-y},
doi = {10.1007/S00500-017-2505-Y},
timestamp = {Tue, 28 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/soco/MaLHGLZ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcbb/ChenLZLWHZXG18,
author = {Shifu Chen and
Ming Liu and
Xiaoni Zhang and
Renwen Long and
Yixing Wang and
Yue Han and
Shiwei Zhang and
Mingyan Xu and
Jia Gu},
title = {A Study of Cell-Free {DNA} Fragmentation Pattern and Its Application
in {DNA} Sample Type Classification},
journal = {{IEEE} {ACM} Trans. Comput. Biol. Bioinform.},
volume = {15},
number = {5},
pages = {1718--1722},
year = {2018},
url = {https://doi.org/10.1109/TCBB.2017.2723388},
doi = {10.1109/TCBB.2017.2723388},
timestamp = {Mon, 03 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcbb/ChenLZLWHZXG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/LinSHL18,
author = {Hongjian Lin and
Zeliang Shu and
Xiaoqiong He and
Ming Liu},
title = {{N-D} {SVPWM} With {DC} Voltage Balancing and Vector Smooth Transition
Algorithm for a Cascaded Multilevel Converter},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {65},
number = {5},
pages = {3837--3847},
year = {2018},
url = {https://doi.org/10.1109/TIE.2017.2764838},
doi = {10.1109/TIE.2017.2764838},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/LinSHL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apweb/LiuLG18,
author = {Ming Liu and
Bo Lang and
Zepeng Gu},
editor = {Yi Cai and
Yoshiharu Ishikawa and
Jianliang Xu},
title = {Similarity Calculations of Academic Articles Using Topic Events and
Domain Knowledge},
booktitle = {Web and Big Data - Second International Joint Conference, APWeb-WAIM
2018, Macau, China, July 23-25, 2018, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {10987},
pages = {45--53},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-319-96890-2\_4},
doi = {10.1007/978-3-319-96890-2\_4},
timestamp = {Tue, 14 May 2019 10:00:51 +0200},
biburl = {https://dblp.org/rec/conf/apweb/LiuLG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apweb/LiuCLZN18,
author = {Ming Liu and
Yang Chen and
Bo Lang and
Li Zhang and
Hongting Niu},
editor = {Yi Cai and
Yoshiharu Ishikawa and
Jianliang Xu},
title = {Identifying Scholarly Communities from Unstructured Texts},
booktitle = {Web and Big Data - Second International Joint Conference, APWeb-WAIM
2018, Macau, China, July 23-25, 2018, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {10987},
pages = {75--89},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-319-96890-2\_7},
doi = {10.1007/978-3-319-96890-2\_7},
timestamp = {Thu, 19 Jul 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/apweb/LiuCLZN18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dicta/DuDLZJLHKH18,
author = {Haoyuan Du and
Liquan Dong and
Ming Liu and
Yuejin Zhao and
Wei Jia and
Xiaohua Liu and
Mei Hui and
Lingqin Kong and
Qun Hao},
title = {Image Restoration Based on Deep Convolutional Network in Wavefront
Coding Imaging System},
booktitle = {2018 Digital Image Computing: Techniques and Applications, {DICTA}
2018, Canberra, Australia, December 10-13, 2018},
pages = {1--8},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/DICTA.2018.8615824},
doi = {10.1109/DICTA.2018.8615824},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/dicta/DuDLZJLHKH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsc/LiuX18,
author = {Ming Liu and
Xifen Xu},
title = {Dockless Bike-Sharing Reallocation Based on Data Analysis: Solving
Complex Problem with Simple Method},
booktitle = {Third {IEEE} International Conference on Data Science in Cyberspace,
{DSC} 2018, Guangzhou, China, June 18-21, 2018},
pages = {445--450},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/DSC.2018.00072},
doi = {10.1109/DSC.2018.00072},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsc/LiuX18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/LiuK18,
author = {Ming Liu and
Younghoon Kim},
title = {Classification of Heart Diseases Based On {ECG} Signals Using Long
Short-Term Memory},
booktitle = {40th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2018, Honolulu, HI, USA, July
18-21, 2018},
pages = {2707--2710},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/EMBC.2018.8512761},
doi = {10.1109/EMBC.2018.8512761},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/LiuK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/WangLLZ18,
author = {Qing Wang and
Ming Liu and
Nian Liu and
Zhangdui Zhong},
title = {On Augmenting {UL} Connections in Massive {MIMO} System Using Composite
Channel Estimation},
booktitle = {{IEEE} Global Communications Conference, {GLOBECOM} 2018, Abu Dhabi,
United Arab Emirates, December 9-13, 2018},
pages = {1--7},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/GLOCOM.2018.8648132},
doi = {10.1109/GLOCOM.2018.8648132},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/globecom/WangLLZ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdm/GongWHLLY18,
author = {Chenxu Gong and
Guoyin Wang and
Jun Hu and
Ming Liu and
Li Liu and
Zihe Yang},
editor = {Hanghang Tong and
Zhenhui Jessie Li and
Feida Zhu and
Jeffrey Yu},
title = {Finding Multi-granularity Community Structures in Social Networks
Based on Significance of Community Partition},
booktitle = {2018 {IEEE} International Conference on Data Mining Workshops, {ICDM}
Workshops, Singapore, Singapore, November 17-20, 2018},
pages = {415--421},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ICDMW.2018.00068},
doi = {10.1109/ICDMW.2018.00068},
timestamp = {Mon, 16 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdm/GongWHLLY18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iciit/ZhangZLYLY18,
author = {Guangli Zhang and
Gang Zhao and
Ming Liu and
Shuqin Yu and
Yali Liu and
Xiongfei Yang},
title = {Prediction of the Fourth Industrial Revolution Based on Time Series},
booktitle = {Proceedings of the 2018 International Conference on Intelligent Information
Technology, {ICIIT} 2018, Hanoi, Vietnam, February 26-28, 2018},
pages = {65--69},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3193063.3193070},
doi = {10.1145/3193063.3193070},
timestamp = {Thu, 12 May 2022 15:06:16 +0200},
biburl = {https://dblp.org/rec/conf/iciit/ZhangZLYLY18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/LiuLJGW18,
author = {Ming Liu and
Yang Liu and
Jue Jiang and
Zhenwei Guo and
Zenan Wang},
title = {Crowd Counting with Fully Convolutional Neural Network},
booktitle = {2018 {IEEE} International Conference on Image Processing, {ICIP} 2018,
Athens, Greece, October 7-10, 2018},
pages = {953--957},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ICIP.2018.8451787},
doi = {10.1109/ICIP.2018.8451787},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/LiuLJGW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmva/YuLLG18,
author = {Ge Yu and
Ming Liu and
Tianyu Liu and
Lili Guo},
title = {Estimation of Point Cloud Object Pose Using Particle Swarm Optimization},
booktitle = {Proceedings of the International Conference on Machine Vision and
Applications, {ICMVA} 2018, Singapore, April 23-25, 2018},
pages = {1--7},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3220511.3220512},
doi = {10.1145/3220511.3220512},
timestamp = {Fri, 13 May 2022 09:42:06 +0200},
biburl = {https://dblp.org/rec/conf/icmva/YuLLG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsoc/LiuX18,
author = {Ming Liu and
Xifen Xu},
editor = {Xiao Liu and
Michael Mrissa and
Liang Zhang and
Djamal Benslimane and
Aditya Ghose and
Zhongjie Wang and
Antonio Bucchiarone and
Wei Zhang and
Ying Zou and
Qi Yu},
title = {A Data-Driven Optimization Method for Reallocating the Free-Floating
Bikes},
booktitle = {Service-Oriented Computing - {ICSOC} 2018 Workshops - ADMS, ASOCA,
ISYyCC, CloTS, DDBS, and NLS4IoT, Hangzhou, China, November 12-15,
2018, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {11434},
pages = {3--13},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-17642-6\_1},
doi = {10.1007/978-3-030-17642-6\_1},
timestamp = {Mon, 26 Jun 2023 20:44:14 +0200},
biburl = {https://dblp.org/rec/conf/icsoc/LiuX18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/ZhuKLLYL18,
author = {Min Zhu and
Qiqi Kuang and
Jianjun Lin and
Qihong Luo and
Chunling Yang and
Ming Liu},
title = {A {Z} Structure Convolutional Neural Network Implemented by {FPGA}
in Deep Learning},
booktitle = {{IECON} 2018 - 44th Annual Conference of the {IEEE} Industrial Electronics
Society, Washington, DC, USA, October 21-23, 2018},
pages = {2677--2682},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IECON.2018.8592775},
doi = {10.1109/IECON.2018.8592775},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iecon/ZhuKLLYL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ZhouLLL18,
author = {Gaoxiang Zhou and
Ming Liu and
Xiangnan Liu and
Jonathan Li},
title = {Combination of Crop Growth Model and Radiation Transfer Model with
Remote Sensing Data Assimilation for Fapar Estimation},
booktitle = {2018 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2018, Valencia, Spain, July 22-27, 2018},
pages = {1882--1885},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IGARSS.2018.8518090},
doi = {10.1109/IGARSS.2018.8518090},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/ZhouLLL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ChenGLL18,
author = {Mengge Chen and
Yue Gu and
Ming Liu and
Jonathan Li},
title = {Estimating {PM} 2.5 in British Columbia Before and After Wildfires
using 3 {KM} Modis {AOD} Products from February to August 2017},
booktitle = {2018 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2018, Valencia, Spain, July 22-27, 2018},
pages = {7585--7588},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IGARSS.2018.8517475},
doi = {10.1109/IGARSS.2018.8517475},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/ChenGLL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/LiuQHDL18,
author = {Junbin Liu and
Xiaolan Qiu and
Lijia Huang and
Chibiao Ding and
Ming Liu},
title = {Curved-Path {SAR} Geolocation Error Analysis Based on {BP} Algorithm},
booktitle = {2018 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2018, Valencia, Spain, July 22-27, 2018},
pages = {8901--8904},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IGARSS.2018.8517390},
doi = {10.1109/IGARSS.2018.8517390},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/LiuQHDL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/FowersOPMLLAHAG18,
author = {Jeremy Fowers and
Kalin Ovtcharov and
Michael Papamichael and
Todd Massengill and
Ming Liu and
Daniel Lo and
Shlomi Alkalay and
Michael Haselman and
Logan Adams and
Mahdi Ghandi and
Stephen Heil and
Prerak Patel and
Adam Sapek and
Gabriel Weisz and
Lisa Woods and
Sitaram Lanka and
Steven K. Reinhardt and
Adrian M. Caulfield and
Eric S. Chung and
Doug Burger},
editor = {Murali Annavaram and
Timothy Mark Pinkston and
Babak Falsafi},
title = {A Configurable Cloud-Scale {DNN} Processor for Real-Time {AI}},
booktitle = {45th {ACM/IEEE} Annual International Symposium on Computer Architecture,
{ISCA} 2018, Los Angeles, CA, USA, June 1-6, 2018},
pages = {1--14},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/ISCA.2018.00012},
doi = {10.1109/ISCA.2018.00012},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isca/FowersOPMLLAHAG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/XieLLLZWG18,
author = {Yang Xie and
Dan Li and
Yiqun Liu and
Ming Liu and
Yihua Zhang and
Xiaoli Wang and
Li Geng},
title = {Low-Noise High-Linearity 56Gb/s {PAM-4} Optical Receiver in 45nm {SOI}
{CMOS}},
booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2018,
27-30 May 2018, Florence, Italy},
pages = {1--4},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ISCAS.2018.8351224},
doi = {10.1109/ISCAS.2018.8351224},
timestamp = {Fri, 02 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/XieLLLZWG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-08895,
author = {Naihan Li and
Shujie Liu and
Yanqing Liu and
Sheng Zhao and
Ming Liu and
Ming Zhou},
title = {Close to Human Quality {TTS} with Transformer},
journal = {CoRR},
volume = {abs/1809.08895},
year = {2018},
url = {http://arxiv.org/abs/1809.08895},
eprinttype = {arXiv},
eprint = {1809.08895},
timestamp = {Fri, 05 Oct 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1809-08895.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/brain/GaoZLLWCLGLCJHL17,
author = {Zhenni Gao and
Delong Zhang and
Aiying Liang and
Bishan Liang and
Zengjian Wang and
Yuxuan Cai and
Junchao Li and
Mengxia Gao and
Xiaojin Liu and
Song Chang and
Bingqing Jiao and
Ruiwang Huang and
Ming Liu},
title = {Exploring the Associations Between Intrinsic Brain Connectivity and
Creative Ability Using Functional Connectivity Strength and Connectome
Analysis},
journal = {Brain Connect.},
volume = {7},
number = {9},
pages = {590--601},
year = {2017},
url = {https://doi.org/10.1089/brain.2017.0510},
doi = {10.1089/BRAIN.2017.0510},
timestamp = {Mon, 11 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/brain/GaoZLLWCLGLCJHL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ccsecis/LiuZHLZ17,
author = {Shuaiqi Liu and
Yu Zhang and
Qi Hu and
Ming Liu and
Jie Zhao},
title = {{SAR} Image De-Noising based on GNL-Means with Optimized Pixel-Wise
Weighting in Non-Subsample Shearlet Domain},
journal = {Comput. Inf. Sci.},
volume = {10},
number = {1},
pages = {16--22},
year = {2017},
url = {https://doi.org/10.5539/cis.v10n1p16},
doi = {10.5539/CIS.V10N1P16},
timestamp = {Tue, 28 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ccsecis/LiuZHLZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cma/YangLZ17,
author = {Ruizhi Yang and
Ming Liu and
Chunrui Zhang},
title = {A diffusive toxin producing phytoplankton model with maturation delay
and three-dimensional patch},
journal = {Comput. Math. Appl.},
volume = {73},
number = {5},
pages = {824--837},
year = {2017},
url = {https://doi.org/10.1016/j.camwa.2017.01.006},
doi = {10.1016/J.CAMWA.2017.01.006},
timestamp = {Thu, 11 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cma/YangLZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cnsns/YangLZ17,
author = {Ruizhi Yang and
Ming Liu and
Chunrui Zhang},
title = {A delayed-diffusive predator-prey model with a ratio-dependent functional
response},
journal = {Commun. Nonlinear Sci. Numer. Simul.},
volume = {53},
pages = {94--110},
year = {2017},
url = {https://doi.org/10.1016/j.cnsns.2017.04.034},
doi = {10.1016/J.CNSNS.2017.04.034},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cnsns/YangLZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cssp/LiuY17,
author = {Ming Liu and
Wei Yang},
title = {Network-Based Filtering for Stochastic Markovian Jump Systems with
Application to PWM-Driven Boost Converter},
journal = {Circuits Syst. Signal Process.},
volume = {36},
number = {8},
pages = {3071--3097},
year = {2017},
url = {https://doi.org/10.1007/s00034-016-0452-y},
doi = {10.1007/S00034-016-0452-Y},
timestamp = {Sun, 21 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cssp/LiuY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/LiuWLZ17,
author = {Ming Liu and
Mingjiang Wang and
De Liu and
Boya Zhao},
title = {{VLSI} implementation of the modified sign-error {LMS} adaptive algorithm},
journal = {{IEICE} Electron. Express},
volume = {14},
number = {7},
pages = {20161001},
year = {2017},
url = {https://doi.org/10.1587/elex.13.20161001},
doi = {10.1587/ELEX.13.20161001},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieiceee/LiuWLZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/LiuWLZ17a,
author = {Ming Liu and
Mingjiang Wang and
De Liu and
Boya Zhao},
title = {Delay-optimized realization of 2-parallel delayed {LMS} adaptive {FIR}
filter},
journal = {{IEICE} Electron. Express},
volume = {14},
number = {8},
pages = {20170225},
year = {2017},
url = {https://doi.org/10.1587/elex.14.20170225},
doi = {10.1587/ELEX.14.20170225},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieiceee/LiuWLZ17a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/ZhaoWL17,
author = {Boya Zhao and
Mingjiang Wang and
Ming Liu},
title = {An energy-efficient coarse grained spatial architecture for convolutional
neural networks AlexNet},
journal = {{IEICE} Electron. Express},
volume = {14},
number = {15},
pages = {20170595},
year = {2017},
url = {https://doi.org/10.1587/elex.14.20170595},
doi = {10.1587/ELEX.14.20170595},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieiceee/ZhaoWL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijfs/LuLL17,
author = {Xingguo Lu and
Ming Liu and
Jianxing Liu},
title = {Design and Optimization of Interval Type-2 Fuzzy Logic Controller
for Delta Parallel Robot Trajectory Control},
journal = {Int. J. Fuzzy Syst.},
volume = {19},
number = {1},
pages = {190--206},
year = {2017},
url = {https://doi.org/10.1007/s40815-015-0131-3},
doi = {10.1007/S40815-015-0131-3},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijfs/LuLL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijgi/LiCLHR17,
author = {Suju Li and
Yan Cui and
Ming Liu and
Haixia He and
Shirish Ravan},
title = {Integrating Global Open Geo-Information for Major Disaster Assessment:
{A} Case Study of the Myanmar Flood},
journal = {{ISPRS} Int. J. Geo Inf.},
volume = {6},
number = {7},
pages = {201},
year = {2017},
url = {https://doi.org/10.3390/ijgi6070201},
doi = {10.3390/IJGI6070201},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijgi/LiCLHR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijprai/WangL17,
author = {Haijun Wang and
Ming Liu},
title = {A Novel Active Contour Model for Image Segmentation and Bias Correction
Using Guided Image Filtering Regularization Term},
journal = {Int. J. Pattern Recognit. Artif. Intell.},
volume = {31},
number = {7},
pages = {1754013:1--1754013:18},
year = {2017},
url = {https://doi.org/10.1142/S0218001417540131},
doi = {10.1142/S0218001417540131},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijprai/WangL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijspm/WangPSHLL17,
author = {Xue Wang and
Ying Pan and
Liyou Song and
Xiaochen Huang and
Ming Liu and
Anqi Liu},
title = {Modelling and application for eclampsia with SimMom},
journal = {Int. J. Simul. Process. Model.},
volume = {12},
number = {2},
pages = {103--110},
year = {2017},
url = {https://doi.org/10.1504/IJSPM.2017.10004191},
doi = {10.1504/IJSPM.2017.10004191},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijspm/WangPSHLL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfi/Zhang0LS17,
author = {Jianqiao Zhang and
Dong Ye and
Ming Liu and
Zhaowei Sun},
title = {Adaptive fuzzy finite-time control for spacecraft formation with communication
delays and changing topologies},
journal = {J. Frankl. Inst.},
volume = {354},
number = {11},
pages = {4377--4403},
year = {2017},
url = {https://doi.org/10.1016/j.jfranklin.2017.04.018},
doi = {10.1016/J.JFRANKLIN.2017.04.018},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jfi/Zhang0LS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lgrs/DuanLDXL17,
author = {Keqing Duan and
Ming Liu and
Huanyao Dai and
Fang Xu and
Weijian Liu},
title = {A Two-Stage Detector for Mismatched Subspace Signals},
journal = {{IEEE} Geosci. Remote. Sens. Lett.},
volume = {14},
number = {12},
pages = {2270--2274},
year = {2017},
url = {https://doi.org/10.1109/LGRS.2017.2761782},
doi = {10.1109/LGRS.2017.2761782},
timestamp = {Thu, 09 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/lgrs/DuanLDXL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/ZhouLZLW17,
author = {Gaoxiang Zhou and
Xiangnan Liu and
Shuang Zhao and
Ming Liu and
Ling Wu},
title = {Estimating {FAPAR} of Rice Growth Period Using Radiation Transfer
Model Coupled with the {WOFOST} Model for Analyzing Heavy Metal Stress},
journal = {Remote. Sens.},
volume = {9},
number = {5},
pages = {424},
year = {2017},
url = {https://doi.org/10.3390/rs9050424},
doi = {10.3390/RS9050424},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/remotesensing/ZhouLZLW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/ZhangSLLS17,
author = {Ping Zhang and
Qiangqiang Sun and
Ming Liu and
Jing Li and
Danfeng Sun},
title = {A Strategy of Rapid Extraction of Built-Up Area Using Multi-Seasonal
Landsat-8 Thermal Infrared Band 10 Images},
journal = {Remote. Sens.},
volume = {9},
number = {11},
pages = {1126},
year = {2017},
url = {https://doi.org/10.3390/rs9111126},
doi = {10.3390/RS9111126},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/ZhangSLLS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scl/ChenHL17,
author = {Shun Chen and
Daniel W. C. Ho and
Ming Liu},
title = {Consensus protocol for multiple delta operator systems},
journal = {Syst. Control. Lett.},
volume = {107},
pages = {1--8},
year = {2017},
url = {https://doi.org/10.1016/j.sysconle.2017.07.001},
doi = {10.1016/J.SYSCONLE.2017.07.001},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/scl/ChenHL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigpro/LiuLZLL17,
author = {Jun Liu and
Kai Li and
Xichuan Zhang and
Ming Liu and
Weijian Liu},
title = {A weighted detector for mismatched subspace signals},
journal = {Signal Process.},
volume = {140},
pages = {110--115},
year = {2017},
url = {https://doi.org/10.1016/j.sigpro.2017.05.011},
doi = {10.1016/J.SIGPRO.2017.05.011},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigpro/LiuLZLL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spl/DongLLTL17,
author = {Yunlong Dong and
Ming Liu and
Kai Li and
Zhikai Tang and
Weijian Liu},
title = {Adaptive Direction Detection in Deterministic Interference and Partially
Homogeneous Noise},
journal = {{IEEE} Signal Process. Lett.},
volume = {24},
number = {5},
pages = {599--603},
year = {2017},
url = {https://doi.org/10.1109/LSP.2017.2683198},
doi = {10.1109/LSP.2017.2683198},
timestamp = {Wed, 14 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/spl/DongLLTL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/LiuLLZZW17,
author = {Shuaiqi Liu and
Ming Liu and
Peifei Li and
Jie Zhao and
Zhihui Zhu and
Xuehu Wang},
title = {{SAR} Image Denoising via Sparse Representation in Shearlet Domain
Based on Continuous Cycle Spinning},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {55},
number = {5},
pages = {2985--2992},
year = {2017},
url = {https://doi.org/10.1109/TGRS.2017.2657602},
doi = {10.1109/TGRS.2017.2657602},
timestamp = {Tue, 28 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/LiuLLZZW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/WanNLWY17,
author = {Neng Wan and
D. Subbaram Naidu and
Ming Liu and
Ligang Wu and
Weiran Yao},
title = {Adaptive sliding mode control for spacecraft rendezvous in near-circular
orbits with time-varying saturation constraint},
booktitle = {2017 American Control Conference, {ACC} 2017, Seattle, WA, USA, May
24-26, 2017},
pages = {5812--5817},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.23919/ACC.2017.7963861},
doi = {10.23919/ACC.2017.7963861},
timestamp = {Fri, 03 Dec 2021 13:04:31 +0100},
biburl = {https://dblp.org/rec/conf/amcc/WanNLWY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csps/LiuLLHSZ17,
author = {Shuaiqi Liu and
Pengfei Li and
Ming Liu and
Qi Hu and
Mingzhu Shi and
Jie Zhao},
editor = {Qilian Liang and
Jiasong Mu and
Min Jia and
Wei Wang and
Xuhong Feng and
Baoju Zhang},
title = {{DTI} Image Denoising Based on Complex Shearlet Domain and Complex
Diffusion Anisotropic Filtering},
booktitle = {Communications, Signal Processing, and Systems - Proceedings of the
2017 International Conference on Communications, Signal Processing,
and Systems, {CSPS} 2017, Harbin, China, 14-16 July 2017},
series = {Lecture Notes in Electrical Engineering},
volume = {463},
pages = {706--713},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-981-10-6571-2\_86},
doi = {10.1007/978-981-10-6571-2\_86},
timestamp = {Tue, 28 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/csps/LiuLLHSZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csps/LiuLD17,
author = {Ming Liu and
Zhi{-}gang Li and
Zheng Dou},
editor = {Qilian Liang and
Jiasong Mu and
Min Jia and
Wei Wang and
Xuhong Feng and
Baoju Zhang},
title = {Rainfall Attenuation Characteristic Analysis in Ka-band Satellite
Communication System},
booktitle = {Communications, Signal Processing, and Systems - Proceedings of the
2017 International Conference on Communications, Signal Processing,
and Systems, {CSPS} 2017, Harbin, China, 14-16 July 2017},
series = {Lecture Notes in Electrical Engineering},
volume = {463},
pages = {1278--1285},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-981-10-6571-2\_153},
doi = {10.1007/978-981-10-6571-2\_153},
timestamp = {Sat, 11 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/csps/LiuLD17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icarm/LiLZGLW17,
author = {Mantian Li and
Ming Liu and
Fusheng Zha and
Wei Guo and
Mingbi Lu and
Xin Wang},
title = {Research on algorithms of neural network based on self-growing of
neuron},
booktitle = {2nd International Conference on Advanced Robotics and Mechatronics,
{ICARM} 2017, Hefei and Tai'an, China, August 27-31, 2017},
pages = {570--575},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ICARM.2017.8273225},
doi = {10.1109/ICARM.2017.8273225},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/icarm/LiLZGLW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icbl/FanLW17,
author = {Min{-}sheng Fan and
Ming Liu and
Yu Wang},
editor = {Simon K. S. Cheung and
Lam{-}for Kwok and
Will W. K. Ma and
Lap{-}Kei Lee and
Harrison Hao Yang},
title = {Research on Blended Learning Model Based on Electronic Schoolbag},
booktitle = {Blended Learning. New Challenges and Innovative Practices - 10th International
Conference, {ICBL} 2017, Hong Kong, China, June 27-29, 2017, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {10309},
pages = {151--165},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-59360-9\_14},
doi = {10.1007/978-3-319-59360-9\_14},
timestamp = {Tue, 14 May 2019 10:00:41 +0200},
biburl = {https://dblp.org/rec/conf/icbl/FanLW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpads/LiLXL17,
author = {Defeng Li and
Ming Liu and
Xiaogang Xu and
Junhua Li},
title = {State Identification of Cabinets Based on Convolution Neural Network},
booktitle = {23rd {IEEE} International Conference on Parallel and Distributed Systems,
{ICPADS} 2017, Shenzhen, China, December 15-17, 2017},
pages = {761--764},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/ICPADS.2017.00102},
doi = {10.1109/ICPADS.2017.00102},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpads/LiLXL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieeesensors/LiuLRSLYTJ17,
author = {Yantao Liu and
Dan Liu and
Wei Ren and
Peng Shi and
Ming Liu and
Zuo{-}Guang Ye and
Bian Tian and
Zhuangde Jiang},
title = {Enhanced stability of ITO/In2O3 thin film thermocouples by coating
Al2O3 layer},
booktitle = {2017 {IEEE} SENSORS, Glasgow, United Kingdom, October 29 - November
1, 2017},
pages = {1--3},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ICSENS.2017.8233926},
doi = {10.1109/ICSENS.2017.8233926},
timestamp = {Mon, 09 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ieeesensors/LiuLRSLYTJ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ised/BanerjeeL17,
author = {Writam Banerjee and
Ming Liu},
title = {Three-dimensional emerging nonvolatile memory for the high-density
and neuromorphic applications},
booktitle = {7th International Symposium on Embedded Computing and System Design,
{ISED} 2017, Durgapur, India, December 18-20, 2017},
pages = {1--5},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ISED.2017.8303905},
doi = {10.1109/ISED.2017.8303905},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/ised/BanerjeeL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/WangLWZ17,
author = {Xiaoyi Wang and
Ming Liu and
Dong Wang and
Caijun Zhong},
title = {Pilot Contamination Attack Detection Using Random Symbols for Massive
{MIMO} Systems},
booktitle = {85th {IEEE} Vehicular Technology Conference, {VTC} Spring 2017, Sydney,
Australia, June 4-7, 2017},
pages = {1--7},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/VTCSpring.2017.8108303},
doi = {10.1109/VTCSPRING.2017.8108303},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vtc/WangLWZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/WangZMZSLZ17,
author = {Qi Wang and
Zhuyan Zhao and
Deshan Miao and
Yuantao Zhang and
Jingyuan Sun and
Ming Liu and
Zhangdui Zhong},
title = {Non-Orthogonal Coded Access for Contention-Based Transmission in 5G},
booktitle = {86th {IEEE} Vehicular Technology Conference, {VTC} Fall 2017, Toronto,
ON, Canada, September 24-27, 2017},
pages = {1--6},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/VTCFall.2017.8288079},
doi = {10.1109/VTCFALL.2017.8288079},
timestamp = {Mon, 20 Dec 2021 11:29:16 +0100},
biburl = {https://dblp.org/rec/conf/vtc/WangZMZSLZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1711-11508,
author = {Ming Liu and
Bo Lang and
Zepeng Gu},
title = {Calculating Semantic Similarity between Academic Articles using Topic
Event and Ontology},
journal = {CoRR},
volume = {abs/1711.11508},
year = {2017},
url = {http://arxiv.org/abs/1711.11508},
eprinttype = {arXiv},
eprint = {1711.11508},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1711-11508.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cssp/YaoLLM16,
author = {Deyin Yao and
Ming Liu and
Hongyi Li and
Haoyi Ma},
title = {Robust Adaptive Sliding Mode Control for Nonlinear Uncertain Neutral
Markovian Jump Systems},
journal = {Circuits Syst. Signal Process.},
volume = {35},
number = {8},
pages = {2741--2761},
year = {2016},
url = {https://doi.org/10.1007/s00034-015-0171-9},
doi = {10.1007/S00034-015-0171-9},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cssp/YaoLLM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eaai/XiongWLZHL16,
author = {Peng Xiong and
Hongrui Wang and
Ming Liu and
Suiping Zhou and
Zengguang Hou and
Xiu{-}Ling Liu},
title = {{ECG} signal enhancement based on improved denoising auto-encoder},
journal = {Eng. Appl. Artif. Intell.},
volume = {52},
pages = {194--202},
year = {2016},
url = {https://doi.org/10.1016/j.engappai.2016.02.015},
doi = {10.1016/J.ENGAPPAI.2016.02.015},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eaai/XiongWLZHL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/WangLLZ16,
author = {Mingjiang Wang and
De Liu and
Ming Liu and
Boya Zhao},
title = {A two-item floating point fused dot-product unit with latency reduced},
journal = {{IEICE} Electron. Express},
volume = {13},
number = {23},
pages = {20160937},
year = {2016},
url = {https://doi.org/10.1587/elex.13.20160937},
doi = {10.1587/ELEX.13.20160937},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieiceee/WangLLZ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jors/LiuZ16,
author = {Ming Liu and
Ding Zhang},
title = {A dynamic logistics model for medical resources allocation in an epidemic
control with demand forecast updating},
journal = {J. Oper. Res. Soc.},
volume = {67},
number = {6},
pages = {841--852},
year = {2016},
url = {https://doi.org/10.1057/jors.2015.105},
doi = {10.1057/JORS.2015.105},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jors/LiuZ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsjkx/WangHFZL16,
author = {Tao Wang and
Lansheng Han and
Cai Fu and
Deqing Zou and
Ming Liu},
title = {{\unicode{36719}}{\unicode{20214}}{\unicode{28431}}{\unicode{27934}}{\unicode{38745}}{\unicode{24577}}{\unicode{26816}}{\unicode{27979}}{\unicode{27169}}{\unicode{22411}}{\unicode{21450}}{\unicode{26816}}{\unicode{27979}}{\unicode{26694}}{\unicode{26550}}
(Static Detection Model and Framework for Software Vulnerability)},
journal = {{\unicode{35745}}{\unicode{31639}}{\unicode{26426}}{\unicode{31185}}{\unicode{23398}}},
volume = {43},
number = {5},
pages = {80--86},
year = {2016},
url = {https://doi.org/10.11896/j.issn.1002-137X.2016.05.015},
doi = {10.11896/J.ISSN.1002-137X.2016.05.015},
timestamp = {Fri, 27 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jsjkx/WangHFZL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pvldb/XuLJLHA16,
author = {Shuotao Xu and
Sungjin Lee and
Sang Woo Jun and
Ming Liu and
Jamey Hicks and
Arvind},
title = {BlueCache: {A} Scalable Distributed Flash-based Key-value Store},
journal = {Proc. {VLDB} Endow.},
volume = {10},
number = {4},
pages = {301--312},
year = {2016},
url = {http://www.vldb.org/pvldb/vol10/p301-xu.pdf},
doi = {10.14778/3025111.3025113},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pvldb/XuLJLHA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taes/ShuiL16,
author = {Penglang Shui and
Ming Liu},
title = {Subband adaptive {GLRT-LTD} for weak moving targets in sea clutter},
journal = {{IEEE} Trans. Aerosp. Electron. Syst.},
volume = {52},
number = {1},
pages = {423--437},
year = {2016},
url = {https://doi.org/10.1109/TAES.2015.140783},
doi = {10.1109/TAES.2015.140783},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taes/ShuiL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taes/ShuiLX16,
author = {Peng{-}Lang Shui and
Ming Liu and
Shu{-}Wen Xu},
title = {Shape-parameter-dependent coherent radar target detection in K-distributed
clutter},
journal = {{IEEE} Trans. Aerosp. Electron. Syst.},
volume = {52},
number = {1},
pages = {451--465},
year = {2016},
url = {https://doi.org/10.1109/TAES.2015.140109},
doi = {10.1109/TAES.2015.140109},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/taes/ShuiLX16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/LiuDDLL16,
author = {Xianglong Liu and
Bowen Du and
Cheng Deng and
Ming Liu and
Bo Lang},
title = {Structure Sensitive Hashing With Adaptive Product Quantization},
journal = {{IEEE} Trans. Cybern.},
volume = {46},
number = {10},
pages = {2252--2264},
year = {2016},
url = {https://doi.org/10.1109/TCYB.2015.2474742},
doi = {10.1109/TCYB.2015.2474742},
timestamp = {Wed, 19 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcyb/LiuDDLL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/ShuLZSZH16,
author = {Zeliang Shu and
Ming Liu and
Li Zhao and
Shasha Song and
Qi Zhou and
Xiaoqiong He},
title = {Predictive Harmonic Control and Its Optimal Digital Implementation
for MMC-Based Active Power Filter},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {63},
number = {8},
pages = {5244--5254},
year = {2016},
url = {https://doi.org/10.1109/TIE.2016.2570202},
doi = {10.1109/TIE.2016.2570202},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/ShuLZSZH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tocs/JunLLHAKXA16,
author = {Sang Woo Jun and
Ming Liu and
Sungjin Lee and
Jamey Hicks and
John Ankcorn and
Myron King and
Shuotao Xu and
Arvind},
title = {BlueDBM: Distributed Flash Storage for Big Data Analytics},
journal = {{ACM} Trans. Comput. Syst.},
volume = {34},
number = {3},
pages = {7:1--7:31},
year = {2016},
url = {https://doi.org/10.1145/2898996},
doi = {10.1145/2898996},
timestamp = {Mon, 19 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tocs/JunLLHAKXA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccbd/LiLL16,
author = {Binyang Li and
Bo Li and
Ming Liu},
title = {{IMFSSC:} An In-Memory Distributed File System Framework for Super
Computing},
booktitle = {7th International Conference on Cloud Computing and Big Data, {CCBD}
2016, Macau, China, November 16-18, 2016},
pages = {132--137},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/CCBD.2016.035},
doi = {10.1109/CCBD.2016.035},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/ccbd/LiLL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/LiuJLHA16,
author = {Ming Liu and
Sang Woo Jun and
Sungjin Lee and
Jamey Hicks and
Arvind},
editor = {Luca Fanucci and
J{\"{u}}rgen Teich},
title = {minFlash: {A} minimalistic clustered flash array},
booktitle = {2016 Design, Automation {\&} Test in Europe Conference {\&}
Exhibition, {DATE} 2016, Dresden, Germany, March 14-18, 2016},
pages = {1255--1260},
publisher = {{IEEE}},
year = {2016},
url = {https://ieeexplore.ieee.org/document/7459503/},
timestamp = {Mon, 19 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/date/LiuJLHA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fast/LeeLJXKA16,
author = {Sungjin Lee and
Ming Liu and
Sang Woo Jun and
Shuotao Xu and
Jihong Kim and
Arvind},
editor = {Angela Demke Brown and
Florentina I. Popovici},
title = {Application-Managed Flash},
booktitle = {14th {USENIX} Conference on File and Storage Technologies, {FAST}
2016, Santa Clara, CA, USA, February 22-25, 2016},
pages = {339--353},
publisher = {{USENIX} Association},
year = {2016},
url = {https://www.usenix.org/conference/fast16/technical-sessions/presentation/lee},
timestamp = {Mon, 19 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fast/LeeLJXKA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icarm/LiuZWCZG16,
author = {Ming Liu and
Xingneng Zhong and
Xin Wang and
Fei Chen and
Fusheng Zha and
Wei Guo},
title = {Motion control for a single-legged robot},
booktitle = {2016 International Conference on Advanced Robotics and Mechatronics,
{ICARM} 2016, Macau, China, August 18-20, 2016},
pages = {336--341},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICARM.2016.7606942},
doi = {10.1109/ICARM.2016.7606942},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/icarm/LiuZWCZG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccse2/YangZYQL16,
author = {Ming Yang and
Wei Zheng and
Ding Yang and
Xiaoli Qin and
Ming Liu},
title = {The trajectory design and analysis of the return flying vehicle},
booktitle = {11th International Conference on Computer Science {\&} Education,
{ICCSE} 2016, Nagoya, Japan, August 23-25, 2016},
pages = {844--847},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICCSE.2016.7581692},
doi = {10.1109/ICCSE.2016.7581692},
timestamp = {Mon, 08 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccse2/YangZYQL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icecsys/LiZXLYG16,
author = {Dan Li and
Zimou Zhang and
Yang Xie and
Ming Liu and
Qian Yang and
Li Geng},
title = {A 25Gb/s low-noise optical receiver in 0.13 {\(\mu\)}m SiGe BiCMOS},
booktitle = {2016 {IEEE} International Conference on Electronics, Circuits and
Systems, {ICECS} 2016, Monte Carlo, Monaco, December 11-14, 2016},
pages = {576--579},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICECS.2016.7841267},
doi = {10.1109/ICECS.2016.7841267},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/icecsys/LiZXLYG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/FanWLLHS16,
author = {Yida Fan and
Wei Wu and
Ming Liu and
Suju Li and
Haixia He and
Yang Shu},
title = {Capacity analysis of {GF} - 4 on the disaster management},
booktitle = {2016 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2016, Beijing, China, July 10-15, 2016},
pages = {3746--3749},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/IGARSS.2016.7729971},
doi = {10.1109/IGARSS.2016.7729971},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/igarss/FanWLLHS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isie/LuLLG16,
author = {Xingguo Lu and
Ming Liu and
Jianxing Liu and
Yuhang Guo},
title = {Derivation and analysis of a self-tuning interval type-2 fuzzy {PI}
controller},
booktitle = {25th {IEEE} International Symposium on Industrial Electronics, {ISIE}
2016, Santa Clara, CA, USA, June 8-10, 2016},
pages = {362--368},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ISIE.2016.7744917},
doi = {10.1109/ISIE.2016.7744917},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/isie/LuLLG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vss/LiuY16,
author = {Ming Liu and
Wei Yang},
title = {Sliding mode control of Markovian jump systems with limited capacity
channel},
booktitle = {14th International Workshop on Variable Structure Systems, {VSS} 2016,
Nanjing, China, June 1-4, 2016},
pages = {442--447},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/VSS.2016.7506960},
doi = {10.1109/VSS.2016.7506960},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/vss/LiuY16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chinaf/LiuWLHLP15,
author = {Lifang Liu and
Dong Wu and
Xuemei Liu and
Zongliang Huo and
Ming Liu and
Liyang Pan},
title = {A 1G-cell floating-gate {NOR} flash memory in 65 nm technology with
100 ns random access time},
journal = {Sci. China Inf. Sci.},
volume = {58},
number = {4},
pages = {1--8},
year = {2015},
url = {https://doi.org/10.1007/s11432-014-5243-0},
doi = {10.1007/S11432-014-5243-0},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/chinaf/LiuWLHLP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/LiuHWLL15,
author = {Ming Liu and
Yude He and
Jiaxin Wang and
Heow Pueh Lee and
Yanchun Liang},
title = {Hybrid intelligent algorithm and its application in geological hazard
risk assessment},
journal = {Neurocomputing},
volume = {149},
pages = {847--853},
year = {2015},
url = {https://doi.org/10.1016/j.neucom.2014.07.050},
doi = {10.1016/J.NEUCOM.2014.07.050},
timestamp = {Tue, 12 Sep 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/LiuHWLL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/YuLMX15,
author = {Xinghu Yu and
Ming Liu and
Lingzhi Meng and
Liangbi Xiang},
title = {Classifying cervical spondylosis based on X-ray quantitative diagnosis},
journal = {Neurocomputing},
volume = {165},
pages = {222--227},
year = {2015},
url = {https://doi.org/10.1016/j.neucom.2015.03.012},
doi = {10.1016/J.NEUCOM.2015.03.012},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/YuLMX15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jirs/SantosoLE15,
author = {Fendy Santoso and
Ming Liu and
Gregory K. Egan},
title = {Robust {\(\mu\)}-synthesis Loop Shaping for Altitude Flight Dynamics
of a Flying-Wing Airframe},
journal = {J. Intell. Robotic Syst.},
volume = {79},
number = {2},
pages = {259--273},
year = {2015},
url = {https://doi.org/10.1007/s10846-014-0059-0},
doi = {10.1007/S10846-014-0059-0},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jirs/SantosoLE15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsjkx/DuHFZL15,
author = {Nan Du and
Lansheng Han and
Cai Fu and
Zhongke Zhang and
Ming Liu},
title = {{\unicode{22522}}{\unicode{20110}}{\unicode{30456}}{\unicode{35782}}{\unicode{24230}}{\unicode{30340}}{\unicode{24694}}{\unicode{24847}}{\unicode{20195}}{\unicode{30721}}{\unicode{26816}}{\unicode{27979}}
(Detection of Malware Code Based on Acquaintance Degree)},
journal = {{\unicode{35745}}{\unicode{31639}}{\unicode{26426}}{\unicode{31185}}{\unicode{23398}}},
volume = {42},
number = {1},
pages = {187--192},
year = {2015},
url = {https://doi.org/10.11896/j.issn.1002-137X.2015.01.042},
doi = {10.11896/J.ISSN.1002-137X.2015.01.042},
timestamp = {Mon, 27 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsjkx/DuHFZL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcst/LiuES15,
author = {Ming Liu and
Gregory K. Egan and
Fendy Santoso},
title = {Modeling, Autopilot Design, and Field Tuning of a {UAV} With Minimum
Control Surfaces},
journal = {{IEEE} Trans. Control. Syst. Technol.},
volume = {23},
number = {6},
pages = {2353--2360},
year = {2015},
url = {https://doi.org/10.1109/TCST.2015.2398316},
doi = {10.1109/TCST.2015.2398316},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcst/LiuES15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/ChenHLL15,
author = {Shun Chen and
Daniel W. C. Ho and
Lulu Li and
Ming Liu},
title = {Fault-Tolerant Consensus of Multi-Agent System With Distributed Adaptive
Protocol},
journal = {{IEEE} Trans. Cybern.},
volume = {45},
number = {10},
pages = {2142--2155},
year = {2015},
url = {https://doi.org/10.1109/TCYB.2014.2366204},
doi = {10.1109/TCYB.2014.2366204},
timestamp = {Fri, 02 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcyb/ChenHLL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fpl/JunLXA15,
author = {Sang Woo Jun and
Ming Liu and
Shuotao Xu and
Arvind},
title = {A transport-layer network for distributed {FPGA} platforms},
booktitle = {25th International Conference on Field Programmable Logic and Applications,
{FPL} 2015, London, United Kingdom, September 2-4, 2015},
pages = {1--4},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/FPL.2015.7293976},
doi = {10.1109/FPL.2015.7293976},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fpl/JunLXA15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fskd/ZengL15,
author = {Weihao Zeng and
Ming Liu},
title = {Hearing environment recognition in hearing aids},
booktitle = {12th International Conference on Fuzzy Systems and Knowledge Discovery,
{FSKD} 2015, Zhangjiajie, China, August 15-17, 2015},
pages = {1556--1560},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/FSKD.2015.7382176},
doi = {10.1109/FSKD.2015.7382176},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/fskd/ZengL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fskd/FanPLL15,
author = {Binwen Fan and
Ga Pan and
Ming Liu and
Chunyang Li},
title = {Design of a home surveillance system based on the android platform},
booktitle = {12th International Conference on Fuzzy Systems and Knowledge Discovery,
{FSKD} 2015, Zhangjiajie, China, August 15-17, 2015},
pages = {2101--2105},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/FSKD.2015.7382275},
doi = {10.1109/FSKD.2015.7382275},
timestamp = {Thu, 25 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fskd/FanPLL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fskd/FanSLL15,
author = {Binwen Fan and
Guoyue Sun and
Ming Liu and
Chunyang Li},
title = {Image acquisition and transmission in the video telephone based on
android},
booktitle = {12th International Conference on Fuzzy Systems and Knowledge Discovery,
{FSKD} 2015, Zhangjiajie, China, August 15-17, 2015},
pages = {2132--2136},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/FSKD.2015.7382281},
doi = {10.1109/FSKD.2015.7382281},
timestamp = {Thu, 25 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fskd/FanSLL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ica3pp/LiuYHF15,
author = {Ming Liu and
Xiaoling Yang and
Fanling Huang and
Yanming Fu},
editor = {Guojun Wang and
Albert Y. Zomaya and
Gregorio Mart{\'{\i}}nez P{\'{e}}rez and
Kenli Li},
title = {Research of {CMABC} Algorithm in Intrusion Detection},
booktitle = {Algorithms and Architectures for Parallel Processing - {ICA3PP} International
Workshops and Symposiums, Zhangjiajie, China, November 18-20, 2015,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9532},
pages = {322--332},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-27161-3\_28},
doi = {10.1007/978-3-319-27161-3\_28},
timestamp = {Sat, 06 Aug 2022 22:05:44 +0200},
biburl = {https://dblp.org/rec/conf/ica3pp/LiuYHF15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icinfa/ZhangLZCT15,
author = {Yunong Zhang and
Ming Liu and
Yinyan Zhang and
Zeqi Chen and
Hongzhou Tan},
title = {{ZG} control for 2-output tracking of 3-input nonlinear system with
{GD} used additionally twice more},
booktitle = {{IEEE} International Conference on Information and Automation, {ICIA}
2015, Lijiang, China, August 8-10, 2015},
pages = {2209--2214},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICInfA.2015.7279654},
doi = {10.1109/ICINFA.2015.7279654},
timestamp = {Mon, 09 Aug 2021 14:54:01 +0200},
biburl = {https://dblp.org/rec/conf/icinfa/ZhangLZCT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icinfa/ZhangCLLT15,
author = {Yunong Zhang and
Zeqi Chen and
Ming Liu and
Zhen Li and
Hongzhou Tan},
title = {Continuous model and verification of G-type Zhang reciprocal {(ZR)}
conquering 1/0 singularity of four kinds},
booktitle = {{IEEE} International Conference on Information and Automation, {ICIA}
2015, Lijiang, China, August 8-10, 2015},
pages = {2215--2220},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICInfA.2015.7279655},
doi = {10.1109/ICINFA.2015.7279655},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icinfa/ZhangCLLT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icinfa/LiCWLGS15,
author = {Wei Li and
Wenwen Chen and
Chong Wang and
Ming Liu and
YunJian Ge and
Quanjun Song},
title = {A 3D path planning approach for quadrotor {UAV} navigation},
booktitle = {{IEEE} International Conference on Information and Automation, {ICIA}
2015, Lijiang, China, August 8-10, 2015},
pages = {2481--2486},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICInfA.2015.7279703},
doi = {10.1109/ICINFA.2015.7279703},
timestamp = {Thu, 16 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icinfa/LiCWLGS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/LuL15,
author = {Xingguo Lu and
Ming Liu},
title = {A fuzzy logic controller tuned with {PSO} for delta robot trajectory
control},
booktitle = {{IECON} 2015 - 41st Annual Conference of the {IEEE} Industrial Electronics
Society, Yokohama, Japan, November 9-12, 2015},
pages = {4345--4351},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/IECON.2015.7392776},
doi = {10.1109/IECON.2015.7392776},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iecon/LuL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/JunLLHAKXA15,
author = {Sang Woo Jun and
Ming Liu and
Sungjin Lee and
Jamey Hicks and
John Ankcorn and
Myron King and
Shuotao Xu and
Arvind},
editor = {Deborah T. Marr and
David H. Albonesi},
title = {BlueDBM: an appliance for big data analytics},
booktitle = {Proceedings of the 42nd Annual International Symposium on Computer
Architecture, Portland, OR, USA, June 13-17, 2015},
pages = {1--13},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2749469.2750412},
doi = {10.1145/2749469.2750412},
timestamp = {Mon, 19 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isca/JunLLHAKXA15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/LiuXZ14,
author = {Ming Liu and
Xiaofeng Xu and
Chunrui Zhang},
title = {Stability and global Hopf bifurcation for neutral {BAM} neural network},
journal = {Neurocomputing},
volume = {145},
pages = {122--130},
year = {2014},
url = {https://doi.org/10.1016/j.neucom.2014.05.051},
doi = {10.1016/J.NEUCOM.2014.05.051},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/LiuXZ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/Dou0GHL14,
author = {Changyong Dou and
Xiaodong Zhang and
Huadong Guo and
Chunming Han and
Ming Liu},
title = {Improving the Geolocation Algorithm for Sensors Onboard the {ISS:}
Effect of Drift Angle},
journal = {Remote. Sens.},
volume = {6},
number = {6},
pages = {4647--4659},
year = {2014},
url = {https://doi.org/10.3390/rs6064647},
doi = {10.3390/RS6064647},
timestamp = {Mon, 25 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/Dou0GHL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/XuLZJ14,
author = {Xiaojie Xu and
Ming Liu and
Zhanbin Zhang and
Yueling Jia},
title = {A Novel High Sensitivity Sensor for Remote Field Eddy Current Non-Destructive
Testing Based on Orthogonal Magnetic Field},
journal = {Sensors},
volume = {14},
number = {12},
pages = {24098--24115},
year = {2014},
url = {https://doi.org/10.3390/s141224098},
doi = {10.3390/S141224098},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/XuLZJ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/HeZOLL14,
author = {Chu He and
Tong Zhuo and
Dan Ou and
Ming Liu and
Mingsheng Liao},
title = {Nonlinear Compressed Sensing-Based {LDA} Topic Model for Polarimetric
{SAR} Image Classification},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {7},
number = {3},
pages = {972--982},
year = {2014},
url = {https://doi.org/10.1109/JSTARS.2013.2293343},
doi = {10.1109/JSTARS.2013.2293343},
timestamp = {Tue, 31 Mar 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/staeors/HeZOLL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/vlc/LiuTL14,
author = {Ming Liu and
Yongmei Tian and
Li Lihua},
title = {A new approach for inner-knuckle-print recognition},
journal = {J. Vis. Lang. Comput.},
volume = {25},
number = {1},
pages = {33--42},
year = {2014},
url = {https://doi.org/10.1016/j.jvlc.2013.10.003},
doi = {10.1016/J.JVLC.2013.10.003},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/vlc/LiuTL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aimech/KongCJL14,
author = {Minxiu Kong and
Zhengsheng Chen and
Chen Ji and
Ming Liu},
title = {Optimal point-to-point motion planning of flexible parallel manipulator
with adaptive Gauss pseudo-spectral method},
booktitle = {{IEEE/ASME} International Conference on Advanced Intelligent Mechatronics,
{AIM} 2014, Besancon, France, July 8-11, 2014},
pages = {852--858},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/AIM.2014.6878186},
doi = {10.1109/AIM.2014.6878186},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/aimech/KongCJL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/ZhouZHDLY14,
author = {Ya Zhou and
Yuejin Zhao and
Yao Hu and
Liquan Dong and
Ming Liu and
Dayuan Yan},
title = {Several issues and possible solutions in compulsory project-based
course},
booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2014, Proceedings,
Madrid, Spain, October 22-25, 2014},
pages = {1--7},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/FIE.2014.7044177},
doi = {10.1109/FIE.2014.7044177},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fie/ZhouZHDLY14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fpga/JunLFA14,
author = {Sang Woo Jun and
Ming Liu and
Kermin Elliott Fleming and
Arvind},
editor = {Vaughn Betz and
George A. Constantinides},
title = {Scalable multi-access flash store for big data analytics},
booktitle = {The 2014 {ACM/SIGDA} International Symposium on Field-Programmable
Gate Arrays, {FPGA} '14, Monterey, CA, {USA} - February 26 - 28, 2014},
pages = {55--64},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2554688.2554789},
doi = {10.1145/2554688.2554789},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fpga/JunLFA14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnc/ZhangLZL14,
author = {Jinbao Zhang and
Ming Liu and
Yongqiang Zhao and
Xingguo Lu},
title = {{P-S-N} curves with parameters estimated by particle swarm optimization
and reliability prediction},
booktitle = {10th International Conference on Natural Computation, {ICNC} 2014,
Xiamen, China, August 19-21, 2014},
pages = {627--631},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ICNC.2014.6975908},
doi = {10.1109/ICNC.2014.6975908},
timestamp = {Wed, 20 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icnc/ZhangLZL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ZhouWHLZLZ14,
author = {Lei Zhou and
Jianjun Wu and
Tangao Hu and
Song Leng and
Jianhui Zhang and
Ming Liu and
Lin Zhao},
title = {The investigation of relationship between integrated surface drought
index {(ISDI)} detected drought condition and crop yield},
booktitle = {2014 {IEEE} Geoscience and Remote Sensing Symposium, {IGARSS} 2014,
Quebec City, QC, Canada, July 13-18, 2014},
pages = {2050--2053},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/IGARSS.2014.6946867},
doi = {10.1109/IGARSS.2014.6946867},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/ZhouWHLZLZ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/intenv/NgRAWPHMLD14,
author = {Jason W. P. Ng and
Dymitr Ruta and
Ahmad Al{-}Rubaie and
Di Wang and
Leigh Powell and
Benjamin Hirsch and
Ming Liu and
Ling Cen and
Ahmed Al Dhanhani},
title = {Smart Learning for the Next Generation Education Environment},
booktitle = {2014 International Conference on Intelligent Environments, Shanghai,
China, June 30 - July 4, 2014},
pages = {333--340},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/IE.2014.73},
doi = {10.1109/IE.2014.73},
timestamp = {Wed, 18 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/intenv/NgRAWPHMLD14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/norchip/LiuD14,
author = {Ming Liu and
Elena Dubrova},
title = {An new approach to reliable FSRs lDesign},
booktitle = {2014 NORCHIP, Tampere, Finland, October 27-28, 2014},
pages = {1--4},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/NORCHIP.2014.7004730},
doi = {10.1109/NORCHIP.2014.7004730},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/norchip/LiuD14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/KlevelandCKACCC14,
author = {Bendik Kleveland and
Jeong Choi and
Jeff Kumala and
Pascal Adam and
Patrick Chen and
Rajesh Chopra and
Antonio Cruz and
Ronald B. David and
Ashish Dixit and
Sinan Doluca and
Mark Hendrickson and
Ben Lee and
Ming Liu and
Michael John Miller and
Mike Morrison and
Byeong Cheol Na and
Jay Patel and
Dipak K. Sikdar and
Michael Sporer and
Clement Szeto and
Anju Tsao and
Jianguang Wang and
Daniel Yau and
Wesley Yu},
title = {Early detection and repair of {VRT} and aging {DRAM} bits by margined
in-field {BIST}},
booktitle = {Symposium on {VLSI} Circuits, {VLSIC} 2014, Digest of Technical Papers,
Honolulu, HI, USA, June 10-13, 2014},
pages = {1--2},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/VLSIC.2014.6858414},
doi = {10.1109/VLSIC.2014.6858414},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/KlevelandCKACCC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/WanL14,
author = {Neng Wan and
Ming Liu},
title = {Partially Independent Robust Control for Thrust-Limited Rendezvous
in Near-Circular Orbits},
journal = {CoRR},
volume = {abs/1409.2332},
year = {2014},
url = {http://arxiv.org/abs/1409.2332},
eprinttype = {arXiv},
eprint = {1409.2332},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/WanL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aeog/WuZLZLD13,
author = {Jianjun Wu and
Lei Zhou and
Ming Liu and
Jie Zhang and
Song Leng and
Chun{-}yuan Diao},
title = {Establishing and assessing the Integrated Surface Drought Index {(ISDI)}
for agricultural drought monitoring in mid-eastern China},
journal = {Int. J. Appl. Earth Obs. Geoinformation},
volume = {23},
pages = {397--410},
year = {2013},
url = {https://doi.org/10.1016/j.jag.2012.11.003},
doi = {10.1016/J.JAG.2012.11.003},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aeog/WuZLZLD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cee/ChenGLYG13,
author = {Yi Chen and
Ge Gao and
Ming Liu and
Huaxiong Yao and
Jinglei Guo},
title = {Convergence rate control for distributed multi-hop wireless mesh networks},
journal = {Comput. Electr. Eng.},
volume = {39},
number = {6},
pages = {1758--1766},
year = {2013},
url = {https://doi.org/10.1016/j.compeleceng.2012.12.003},
doi = {10.1016/J.COMPELECENG.2012.12.003},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cee/ChenGLYG13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdsn/Liu13,
author = {Ming Liu},
title = {A Study of Mobile Sensing Using Smartphones},
journal = {Int. J. Distributed Sens. Networks},
volume = {9},
year = {2013},
url = {https://doi.org/10.1155/2013/272916},
doi = {10.1155/2013/272916},
timestamp = {Sun, 21 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijdsn/Liu13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijprai/WangL13,
author = {Haijun Wang and
Ming Liu},
title = {Active Contours Driven by Local Gaussian Distribution Fitting Energy
Based on Local Entropy},
journal = {Int. J. Pattern Recognit. Artif. Intell.},
volume = {27},
number = {6},
year = {2013},
url = {https://doi.org/10.1142/S0218001413550082},
doi = {10.1142/S0218001413550082},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijprai/WangL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jam/LiuX13a,
author = {Ming Liu and
Yihong Xiao},
title = {Modeling and Analysis of Epidemic Diffusion with Population Migration},
journal = {J. Appl. Math.},
volume = {2013},
pages = {583648:1--583648:8},
year = {2013},
url = {https://doi.org/10.1155/2013/583648},
doi = {10.1155/2013/583648},
timestamp = {Thu, 16 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jam/LiuX13a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/LiCCLSLLLL13,
author = {Zhe Li and
Ying{-}Hong Cai and
Yuen{-}Kit Cheng and
Xiao Lu and
Yong{-}Xian Shao and
Xingshu Li and
Ming Liu and
Peiqing Liu and
Hai{-}Bin Luo},
title = {Identification of Novel Phosphodiesterase-4D Inhibitors Prescreened
by Molecular Dynamics-Augmented Modeling and Validated by Bioassay},
journal = {J. Chem. Inf. Model.},
volume = {53},
number = {4},
pages = {972--981},
year = {2013},
url = {https://doi.org/10.1021/ci400063s},
doi = {10.1021/CI400063S},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcisd/LiCCLSLLLL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/KlevelandMDPCSKVMLB13,
author = {Bendik Kleveland and
Michael John Miller and
Ronald B. David and
Jay Patel and
Rajesh Chopra and
Dipak K. Sikdar and
Jeff Kumala and
Socrates D. Vamvakos and
Mike Morrison and
Ming Liu and
Jayaprakash Balachandran},
title = {An Intelligent {RAM} with Serial I/Os},
journal = {{IEEE} Micro},
volume = {33},
number = {6},
pages = {56--65},
year = {2013},
url = {https://doi.org/10.1109/MM.2013.7},
doi = {10.1109/MM.2013.7},
timestamp = {Tue, 20 Mar 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/micro/KlevelandMDPCSKVMLB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ChenLZL13,
author = {Shifeng Chen and
Ming Liu and
Wei Zhang and
Jianzhuang Liu},
title = {Edge preserving image denoising with a closed form solution},
journal = {Pattern Recognit.},
volume = {46},
number = {3},
pages = {976--988},
year = {2013},
url = {https://doi.org/10.1016/j.patcog.2012.08.014},
doi = {10.1016/J.PATCOG.2012.08.014},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pr/ChenLZL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/GaoL13,
author = {Bo{-}Cai Gao and
Ming Liu},
title = {A Fast Smoothing Algorithm for Post-Processing of Surface Reflectance
Spectra Retrieved from Airborne Imaging Spectrometer Data},
journal = {Sensors},
volume = {13},
number = {10},
pages = {13879--13891},
year = {2013},
url = {https://doi.org/10.3390/s131013879},
doi = {10.3390/S131013879},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/GaoL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/Zhou0ZLL0ZZS13,
author = {Lei Zhou and
Jianjun Wu and
Jianhui Zhang and
Song Leng and
Ming Liu and
Jie Zhang and
Lin Zhao and
Feng{-}ying Zhang and
Yu Shi},
title = {The Integrated Surface Drought Index {(ISDI)} as an Indicator for
Agricultural Drought Monitoring: Theory, Validation, and Application
in Mid-Eastern China},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {6},
number = {3},
pages = {1254--1262},
year = {2013},
url = {https://doi.org/10.1109/JSTARS.2013.2248077},
doi = {10.1109/JSTARS.2013.2248077},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/staeors/Zhou0ZLL0ZZS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cinc/YaoS0CYL13,
author = {Liping Yao and
Kun Sun and
Xin Yang and
Sun Cheng and
Linwei Yu and
Ming Liu},
title = {Mitral Valve Regurgitation: Assessment with Dual Source Computed Tomography},
booktitle = {Computing in Cardiology, CinC 2013, Zaragoza, Spain, September 22-25,
2013},
pages = {827--830},
publisher = {www.cinc.org},
year = {2013},
url = {http://www.cinc.org/archives/2013/pdf/0827.pdf},
timestamp = {Mon, 09 Aug 2021 14:54:04 +0200},
biburl = {https://dblp.org/rec/conf/cinc/YaoS0CYL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsd/LiuMD13,
author = {Ming Liu and
Shohreh Sharif Mansouri and
Elena Dubrova},
title = {A Faster Shift Register Alternative to Filter Generators},
booktitle = {2013 Euromicro Conference on Digital System Design, {DSD} 2013, Los
Alamitos, CA, USA, September 4-6, 2013},
pages = {713--718},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/DSD.2013.81},
doi = {10.1109/DSD.2013.81},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsd/LiuMD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/HuZDLZH13,
author = {Yao Hu and
Ya Zhou and
Liquan Dong and
Ming Liu and
Yuejin Zhao and
Qun Hao},
editor = {Randa L. Shehab and
James J. Sluss and
Deborah Anne Trytten},
title = {Aptitude digging education in project-based course},
booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2013, Oklahoma City,
Oklahoma, USA, October 23-26, 2013},
pages = {41--43},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/FIE.2013.6684785},
doi = {10.1109/FIE.2013.6684785},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fie/HuZDLZH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/ZhouHDLZH13,
author = {Ya Zhou and
Yao Hu and
Liquan Dong and
Ming Liu and
Yuejin Zhao and
Qun Hao},
editor = {Randa L. Shehab and
James J. Sluss and
Deborah Anne Trytten},
title = {Let's do it {OR} deal with it: Teamwork in project-based learning},
booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2013, Oklahoma City,
Oklahoma, USA, October 23-26, 2013},
pages = {1510--1512},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/FIE.2013.6685088},
doi = {10.1109/FIE.2013.6685088},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fie/ZhouHDLZH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/LiWLZM13,
author = {Yuhong Li and
Haimeng Wang and
Ming Liu and
Bofan Zhang and
Huanqu Mao},
title = {Software defined networking for distributed mobility management},
booktitle = {Workshops Proceedings of the Global Communications Conference, {GLOBECOM}
2013, Atlanta, GA, USA, December 9-13, 2013},
pages = {885--889},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/GLOCOMW.2013.6825101},
doi = {10.1109/GLOCOMW.2013.6825101},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/globecom/LiWLZM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/KongCL13,
author = {Chenguang Kong and
Xiaojun Cao and
Ming Liu},
title = {Bayesian-based video sharing in mobile social networks},
booktitle = {2013 {IEEE} Global Communications Conference, {GLOBECOM} 2013, Atlanta,
GA, USA, December 9-13, 2013},
pages = {3132--3137},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/GLOCOM.2013.6831553},
doi = {10.1109/GLOCOM.2013.6831553},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/globecom/KongCL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsenst/LiWLLNLZ13,
author = {Yongxiao Li and
Zinan Wang and
Ming Liu and
Chenglong Liu and
Liangfu Ni and
Zhengbin Li and
Yunfeng Zhang},
title = {Design and test of prototype attitude control system as telescope
stabilizer with fiber optic gyroscopes},
booktitle = {Seventh International Conference on Sensing Technology, {ICST} 2013,
Wellington, New Zealand, December 3-5, 2013},
pages = {650--654},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICSensT.2013.6727733},
doi = {10.1109/ICSENST.2013.6727733},
timestamp = {Mon, 09 Aug 2021 14:54:04 +0200},
biburl = {https://dblp.org/rec/conf/icsenst/LiWLLNLZ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ZhouWGZLZLL13,
author = {Lei Zhou and
Jianjun Wu and
Adu Gong and
Jianhui Zhang and
Ming Liu and
Lin Zhao and
Song Leng and
Xin Lu},
title = {Evaluation of Integrated Surface Drought Index {(ISDI)} via precipitation
data and soil moisture},
booktitle = {2013 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2013, Melbourne, Australia, July 21-26, 2013},
pages = {2840--2843},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/IGARSS.2013.6723416},
doi = {10.1109/IGARSS.2013.6723416},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/ZhouWGZLZLL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscide/LiuHGQ13,
author = {Ming Liu and
Jianyu Huang and
Ming Gao and
Shiyin Qin},
editor = {Changyin Sun and
Fang Fang and
Zhi{-}Hua Zhou and
Wankou Yang and
Zhiyong Liu},
title = {High Performance Super-Resolution Reconstruction of Multiple Images
Based on Fast Registration and Edge Enhancement},
booktitle = {Intelligence Science and Big Data Engineering - 4th International
Conference, IScIDE 2013, Beijing, China, July 31 - August 2, 2013,
Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {8261},
pages = {649--657},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-42057-3\_82},
doi = {10.1007/978-3-642-42057-3\_82},
timestamp = {Tue, 14 May 2019 10:00:39 +0200},
biburl = {https://dblp.org/rec/conf/iscide/LiuHGQ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isie/YangLFG13,
author = {Wei Yang and
Ming Liu and
Yulei Fu and
Huijun Gao},
title = {Network-based fault detection of Markovian jump systems with state-dependent
disturbance},
booktitle = {22nd {IEEE} International Symposium on Industrial Electronics, {ISIE}
2013, Taipei, Taiwan, May 28-31, 2013},
pages = {1--6},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ISIE.2013.6563614},
doi = {10.1109/ISIE.2013.6563614},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isie/YangLFG13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/ChenLLLZL13,
author = {Xin Chen and
Dongmei Li and
Shengfa Liang and
Xiaojing Li and
Shuang Zhan and
Ming Liu},
title = {Novel flexible room temperature {NO2} gas sensor based on polypyrrole
coated SnO2 nanoparticles},
booktitle = {8th {IEEE} International Conference on Nano/Micro Engineered and Molecular
Systems, {NEMS} 2013, Suzhou, China, April 7-10, 2013},
pages = {266--269},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/NEMS.2013.6559729},
doi = {10.1109/NEMS.2013.6559729},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/nems/ChenLLLZL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robio/KongCJYL13,
author = {Minxiu Kong and
Zhengsheng Chen and
Chen Ji and
Wei You and
Ming Liu},
title = {Optimal point-to-point motion planning of heavy-duty industry robot
with indirect method},
booktitle = {{IEEE} International Conference on Robotics and Biomimetics, {ROBIO}
2013, Shenzhen, China, December 12-14, 2013},
pages = {768--773},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ROBIO.2013.6739555},
doi = {10.1109/ROBIO.2013.6739555},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/robio/KongCJYL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cssp/LiuWQ12,
author = {Ming Liu and
Qingling Wang and
Sheng Qu},
title = {State Estimation for Discrete-Time Singular Jump Systems with Non-Accessible
Mode Information},
journal = {Circuits Syst. Signal Process.},
volume = {31},
number = {2},
pages = {761--777},
year = {2012},
url = {https://doi.org/10.1007/s00034-011-9334-5},
doi = {10.1007/S00034-011-9334-5},
timestamp = {Sun, 21 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cssp/LiuWQ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejasp/HeLLSLXL12,
author = {Chu He and
Ming Liu and
Zixian Liao and
Bo Shi and
Xiaonian Liu and
Xin Xu and
Mingsheng Liao},
title = {A learning-based target decomposition method using Kernel {KSVD} for
polarimetric {SAR} image classification},
journal = {{EURASIP} J. Adv. Signal Process.},
volume = {2012},
pages = {159},
year = {2012},
url = {https://doi.org/10.1186/1687-6180-2012-159},
doi = {10.1186/1687-6180-2012-159},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ejasp/HeLLSLXL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijig/WangL12,
author = {Haijun Wang and
Ming Liu},
title = {Medical Images Segmentation Using Active Contours Driven by Global
and Local Image Fitting Energy},
journal = {Int. J. Image Graph.},
volume = {12},
number = {2},
year = {2012},
url = {https://doi.org/10.1142/S0219467812500155},
doi = {10.1142/S0219467812500155},
timestamp = {Tue, 24 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijig/WangL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsysc/LiuZ12,
author = {Ming Liu and
Lindu Zhao},
title = {An integrated and dynamic optimisation model for the multi-level emergency
logistics network in anti-bioterrorism system},
journal = {Int. J. Syst. Sci.},
volume = {43},
number = {8},
pages = {1464--1478},
year = {2012},
url = {https://doi.org/10.1080/00207721.2010.547629},
doi = {10.1080/00207721.2010.547629},
timestamp = {Wed, 22 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijsysc/LiuZ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsysc/LiuY12a,
author = {Ming Liu and
Jia You},
title = {Observer-based controller design for networked control systems with
sensor quantisation and random communication delay},
journal = {Int. J. Syst. Sci.},
volume = {43},
number = {10},
pages = {1901--1912},
year = {2012},
url = {https://doi.org/10.1080/00207721.2011.555013},
doi = {10.1080/00207721.2011.555013},
timestamp = {Wed, 22 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijsysc/LiuY12a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijwmc/WangZLJ12,
author = {Qinmin Wang and
Zhongpei Zhang and
Ming Liu and
Fengke Jie},
title = {An iterative algorithm for multi-user inference channel based on subspace
projection},
journal = {Int. J. Wirel. Mob. Comput.},
volume = {5},
number = {4},
pages = {374--379},
year = {2012},
url = {https://doi.org/10.1504/IJWMC.2012.051515},
doi = {10.1504/IJWMC.2012.051515},
timestamp = {Fri, 03 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijwmc/WangZLJ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/itc/LiuLLS12,
author = {Ming Liu and
Quan Bing Liu and
Chao Yuan Liu and
Jie Cheng Sun},
title = {Data Evolvement Analysis Based on Topology Self-Adaptive Clustering
algorithm},
journal = {Inf. Technol. Control.},
volume = {41},
number = {2},
pages = {162--172},
year = {2012},
url = {https://doi.org/10.5755/j01.itc.41.2.974},
doi = {10.5755/J01.ITC.41.2.974},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/itc/LiuLLS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jam/LiuX12a,
author = {Ming Liu and
Yihong Xiao},
title = {Modeling and Analysis of Epidemic Diffusion within Small-World Network},
journal = {J. Appl. Math.},
volume = {2012},
pages = {841531:1--841531:14},
year = {2012},
url = {https://doi.org/10.1155/2012/841531},
doi = {10.1155/2012/841531},
timestamp = {Thu, 16 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jam/LiuX12a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfi/LiuS12,
author = {Ming Liu and
Guanghui Sun},
title = {Observer-based sliding mode control for It{\^{o}} stochastic time-delay
systems with limited capacity channel},
journal = {J. Frankl. Inst.},
volume = {349},
number = {4},
pages = {1602--1616},
year = {2012},
url = {https://doi.org/10.1016/j.jfranklin.2011.06.021},
doi = {10.1016/J.JFRANKLIN.2011.06.021},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jfi/LiuS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsce/LiGLL12,
author = {Hongyi Li and
Huijun Gao and
Honghai Liu and
Ming Liu},
title = {Fault-tolerant \emph{H} \({}_{\mbox{{\(\infty\)}}}\) control for active
suspension vehicle systems with actuator faults},
journal = {J. Syst. Control. Eng.},
volume = {226},
number = {3},
pages = {348--363},
year = {2012},
url = {https://doi.org/10.1177/0959651811418401},
doi = {10.1177/0959651811418401},
timestamp = {Fri, 05 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jsce/LiGLL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsw/LiWLXW12,
author = {Kunlun Li and
Miao Wang and
Ming Liu and
Ruining Xin and
Pan Wang},
title = {A New Semi-supervised Method for Lip Contour Detection},
journal = {J. Softw.},
volume = {7},
number = {12},
pages = {2763--2770},
year = {2012},
url = {https://doi.org/10.4304/jsw.7.12.2763-2770},
doi = {10.4304/JSW.7.12.2763-2770},
timestamp = {Tue, 15 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsw/LiWLXW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mvl/DubrovaLT12,
author = {Elena Dubrova and
Ming Liu and
Maxim Teslenko},
title = {Finding Attractors in Synchronous Multiple-Valued Networks Using SAT-based
Bounded Model Checking},
journal = {J. Multiple Valued Log. Soft Comput.},
volume = {19},
number = {1-3},
pages = {109--131},
year = {2012},
url = {http://www.oldcitypublishing.com/journals/mvlsc-home/mvlsc-issue-contents/mvlsc-volume-19-number-1-3-2012/mvlsc-19-1-3-p-109-131/},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mvl/DubrovaLT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigpro/YangLS12,
author = {Wei Yang and
Ming Liu and
Ping Shi},
title = {H\({}_{\mbox{{\(\infty\)}}}\) filtering for nonlinear stochastic systems
with sensor saturation, quantization and random packet losses},
journal = {Signal Process.},
volume = {92},
number = {6},
pages = {1387--1396},
year = {2012},
url = {https://doi.org/10.1016/j.sigpro.2011.11.019},
doi = {10.1016/J.SIGPRO.2011.11.019},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigpro/YangLS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/HeLXLL12,
author = {Chu He and
Longzhu Liu and
Lianyu Xu and
Ming Liu and
Mingsheng Liao},
title = {Learning Based Compressed Sensing for {SAR} Image Super-Resolution},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {5},
number = {4},
pages = {1272--1281},
year = {2012},
url = {https://doi.org/10.1109/JSTARS.2012.2189555},
doi = {10.1109/JSTARS.2012.2189555},
timestamp = {Tue, 31 Mar 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/staeors/HeLXLL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aclnews/ZhangLKL12,
author = {Min Zhang and
Haizhou Li and
A. Kumaran and
Ming Liu},
editor = {Min Zhang and
Haizhou Li and
A. Kumaran},
title = {Whitepaper of {NEWS} 2012 Shared Task on Machine Transliteration},
booktitle = {Proceedings of the 4th Named Entity Workshop, NEWS@ACL 2012, Jeju,
Korea, July 12, 2012},
pages = {1--9},
publisher = {Association for Computational Linguistics},
year = {2012},
url = {https://aclanthology.org/W12-4401/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aclnews/ZhangLKL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aclnews/ZhangLKL12a,
author = {Min Zhang and
Haizhou Li and
A. Kumaran and
Ming Liu},
editor = {Min Zhang and
Haizhou Li and
A. Kumaran},
title = {Report of {NEWS} 2012 Machine Transliteration Shared Task},
booktitle = {Proceedings of the 4th Named Entity Workshop, NEWS@ACL 2012, Jeju,
Korea, July 12, 2012},
pages = {10--20},
publisher = {Association for Computational Linguistics},
year = {2012},
url = {https://aclanthology.org/W12-4402/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aclnews/ZhangLKL12a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bhi/ZhangLZWKX12,
author = {Shulin Zhang and
Ming Liu and
Jia Zeng and
Yongliang Wang and
Xiangyan Kong and
Xiaoming Xie},
title = {Signal integrity evaluation for fetal magnetocardiography},
booktitle = {Proceedings of 2012 {IEEE-EMBS} International Conference on Biomedical
and Health Informatics, Hong Kong, China, January 5-7, 2012},
pages = {253--256},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/BHI.2012.6211559},
doi = {10.1109/BHI.2012.6211559},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bhi/ZhangLZWKX12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmei/LiuLLC12,
author = {Ming Liu and
Long Liang and
Gang Liu and
Shiqiang Cui},
editor = {Tianqi Zhang},
title = {Synthesis, properties and application in optical memory of a photochromic
diarylethene bearing pyrimidine ring},
booktitle = {5th International Conference on BioMedical Engineering and Informatics,
{BMEI} 2012, Chongqing, China, October 16-18, 2012},
pages = {1351--1354},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/BMEI.2012.6512898},
doi = {10.1109/BMEI.2012.6512898},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/bmei/LiuLLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/complenet/LiuD12,
author = {Ming Liu and
Elena Dubrova},
editor = {Ronaldo Menezes and
Alexandre G. Evsukoff and
Marta C. Gonz{\'{a}}lez},
title = {The Robustness of Balanced Boolean Networks},
booktitle = {Complex Networks, results of the 3rd Workshop on Complex Networks,
CompleNet 2012, Melbourne, FL, USA, March 7-9, 2012},
series = {Studies in Computational Intelligence},
volume = {424},
pages = {19--30},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-30287-9\_3},
doi = {10.1007/978-3-642-30287-9\_3},
timestamp = {Wed, 14 Nov 2018 10:56:06 +0100},
biburl = {https://dblp.org/rec/conf/complenet/LiuD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12,
author = {Socrates D. Vamvakos and
Bendik Kleveland and
Dipak K. Sikdar and
B. K. Ahuja and
Haidang Lin and
Jayaprakash Balachandran and
Wignes Balakrishnan and
Aldo Bottelli and
Jawji Chen and
Xiaole Chen and
Jae Choi and
Jeong Choi and
Rajesh Chopra and
Sanjay Dabral and
Kalyan Dasari and
Ronald B. David and
Shaishav Desai and
Claude R. Gauthier and
Mahmudul Hassan and
Kuo{-}Chiang Hsieh and
Ramosan Canagasaby and
Jeff Kumala and
E. P. Kwon and
Ben Lee and
Ming Liu and
Gurupada Mandal and
Sundari Mitra and
Byeong Cheol Na and
Siddharth Panwar and
Jay Patel and
Chethan Rao and
Vithal Rao and
Richard Rouse and
Ritesh Saraf and
Subramanian Seshadri and
Jae{-}K. Sim and
Clement Szeto and
Alvin Wang and
Jason Yeung},
title = {A 576 Mb {DRAM} with 16-channel 10.3125Gbps serial {I/O} and 14.5
ns latency},
booktitle = {Proceedings of the 38th European Solid-State Circuit conference, {ESSCIRC}
2012, Bordeaux, France, September 17-21, 2012},
pages = {458--461},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ESSCIRC.2012.6341354},
doi = {10.1109/ESSCIRC.2012.6341354},
timestamp = {Thu, 26 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ZhouWLLZZDZLZS12,
author = {Lei Zhou and
Jianjun Wu and
Song Leng and
Ming Liu and
Jie Zhang and
Lin Zhao and
Chun{-}yuan Diao and
Jianhui Zhang and
Hai{-}jiang Luo and
Feng{-}ying Zhang and
Yu Shi},
title = {Using a new integrated drought monitoring index to improve drought
detection in mid-eastern China},
booktitle = {2012 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2012, Munich, Germany, July 22-27, 2012},
pages = {883--886},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/IGARSS.2012.6351417},
doi = {10.1109/IGARSS.2012.6351417},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/ZhouWLLZZDZLZS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/LiuNO12,
author = {Ming Liu and
Tatsuo Nakagawa and
Kenichi Osada},
title = {Fully digital voltage-mode control based on predictive hysteresis
method {(FDVC-PH)} for {DC-DC} converters},
booktitle = {2012 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
2012, Seoul, Korea (South), May 20-23, 2012},
pages = {448--451},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISCAS.2012.6272060},
doi = {10.1109/ISCAS.2012.6272060},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/LiuNO12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmno/LiuZ11,
author = {Ming Liu and
Lindu Zhao},
title = {Analysis for epidemic diffusion and emergency demand in an anti-bioterrorism
system},
journal = {Int. J. Math. Model. Numer. Optimisation},
volume = {2},
number = {1},
pages = {51--68},
year = {2011},
url = {https://doi.org/10.1504/IJMMNO.2011.037199},
doi = {10.1504/IJMMNO.2011.037199},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmno/LiuZ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmor/LiuZS11,
author = {Ming Liu and
Lindu Zhao and
Hans{-}J{\"{u}}rgen Sebastian},
title = {Mixed-collaborative distribution mode for emergency resources in an
anti-bioterrorism system},
journal = {Int. J. Math. Oper. Res.},
volume = {3},
number = {2},
pages = {148--169},
year = {2011},
url = {https://doi.org/10.1504/IJMOR.2011.038908},
doi = {10.1504/IJMOR.2011.038908},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmor/LiuZS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfi/LiuW011,
author = {Ming Liu and
Qingling Wang and
Hongyi Li},
title = {State estimation and stabilization for nonlinear networked control
systems with limited capacity channel},
journal = {J. Frankl. Inst.},
volume = {348},
number = {8},
pages = {1869--1885},
year = {2011},
url = {https://doi.org/10.1016/j.jfranklin.2011.05.008},
doi = {10.1016/J.JFRANKLIN.2011.05.008},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jfi/LiuW011.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jips/ZouHLL11,
author = {Mengsong Zou and
Lansheng Han and
Ming Liu and
Qiwen Liu},
title = {Virus Detection Method based on Behavior Resource Tree},
journal = {J. Inf. Process. Syst.},
volume = {7},
number = {1},
pages = {173--186},
year = {2011},
url = {https://doi.org/10.3745/JIPS.2011.7.1.173},
doi = {10.3745/JIPS.2011.7.1.173},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jips/ZouHLL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/FuGLLHC11,
author = {Cai Fu and
Xiang Gao and
Ming Liu and
Xiaoyang Liu and
Lansheng Han and
Jing Chen},
title = {{GRAP:} Grey risk assessment based on projection in ad hoc networks},
journal = {J. Parallel Distributed Comput.},
volume = {71},
number = {9},
pages = {1249--1260},
year = {2011},
url = {https://doi.org/10.1016/j.jpdc.2010.11.012},
doi = {10.1016/J.JPDC.2010.11.012},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jpdc/FuGLLHC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigpro/LiuYM11,
author = {Ming Liu and
Jia You and
Xincheng Ma},
title = {H\({}_{\mbox{{\(\infty\)}}}\) filtering for sampled-data stochastic
systems with limited capacity channel},
journal = {Signal Process.},
volume = {91},
number = {8},
pages = {1826--1837},
year = {2011},
url = {https://doi.org/10.1016/j.sigpro.2011.02.006},
doi = {10.1016/J.SIGPRO.2011.02.006},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigpro/LiuYM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/TanachutiwatLW11,
author = {Sansiri Tanachutiwat and
Ming Liu and
Wei Wang},
title = {{FPGA} Based on Integration of {CMOS} and {RRAM}},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {19},
number = {11},
pages = {2023--2032},
year = {2011},
url = {https://doi.org/10.1109/TVLSI.2010.2063444},
doi = {10.1109/TVLSI.2010.2063444},
timestamp = {Wed, 11 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvlsi/TanachutiwatLW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aclnews/ZhangLKL11,
author = {Min Zhang and
Haizhou Li and
A. Kumaran and
Ming Liu},
editor = {Min Zhang and
Haizhou Li and
A. Kumaran},
title = {Report of {NEWS} 2011 Machine Transliteration Shared Task},
booktitle = {Proceedings of the 3rd Named Entities Workshop, NEWS@IJCNLP 2011,
Chiang Mai, Thailand, November 12, 2011},
pages = {1--13},
publisher = {Asian Federation of Natural Language Processing},
year = {2011},
url = {https://aclanthology.org/W11-3201/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aclnews/ZhangLKL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csise/SunZLYL11,
author = {Yan Sun and
Shishun Zhu and
Ming Liu and
Peng Ye and
Sujun Luo},
editor = {David Jin and
Sally Lin},
title = {Performance Simulation of Hybrid Power Tactical Vehicle Based on AMESim},
booktitle = {Advances in Computer Science, Intelligent System and Environment [Proceedings
of {CSISE} 2011, Volume 2, September 24-25, 2011, Guangzhou, China]},
series = {Advances in Intelligent and Soft Computing},
volume = {105},
pages = {759--765},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-23756-0\_122},
doi = {10.1007/978-3-642-23756-0\_122},
timestamp = {Fri, 19 May 2017 01:26:02 +0200},
biburl = {https://dblp.org/rec/conf/csise/SunZLYL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/MuWLLZCXD11,
author = {Shuai Mu and
Chenxi Wang and
Ming Liu and
Dongdong Li and
Maohua Zhu and
Xiaoliang Chen and
Xiang Xie and
Yangdong Deng},
title = {Evaluating the potential of graphics processors for high performance
embedded computing},
booktitle = {Design, Automation and Test in Europe, {DATE} 2011, Grenoble, France,
March 14-18, 2011},
pages = {709--714},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/DATE.2011.5763120},
doi = {10.1109/DATE.2011.5763120},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/date/MuWLLZCXD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emeit/LiLGH11,
author = {Ming Li and
Ming Liu and
Lin Gong and
Dingjun Hu},
title = {Scene simulation of navigation simulator based on Creator and Vega},
booktitle = {International Conference on Electronic and Mechanical Engineering
and Information Technology, {EMEIT} 2011, Harbin, Heilongjiang, China,
12-14 August, 2011},
pages = {138--140},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/EMEIT.2011.6022881},
doi = {10.1109/EMEIT.2011.6022881},
timestamp = {Mon, 09 Aug 2021 14:53:48 +0200},
biburl = {https://dblp.org/rec/conf/emeit/LiLGH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iconip/LiL11,
author = {Xiaolin Li and
Ming Liu},
editor = {Bao{-}Liang Lu and
Liqing Zhang and
James T. Kwok},
title = {Improved Global Robust Stability Criteria for Delayed {BAM} Neural
Networks},
booktitle = {Neural Information Processing - 18th International Conference, {ICONIP}
2011, Shanghai, China, November 13-17, 2011, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {7064},
pages = {307--314},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-24965-5\_34},
doi = {10.1007/978-3-642-24965-5\_34},
timestamp = {Tue, 14 May 2019 10:00:42 +0200},
biburl = {https://dblp.org/rec/conf/iconip/LiL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/HeLLFL11,
author = {Chu He and
Longzhu Liu and
Ming Liu and
Qian Feng and
Mingsheng Liao},
title = {{SAR} super resolution via multi-dictionary},
booktitle = {2011 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2011, Vancouver, BC, Canada, July 24-29, 2011},
pages = {366--369},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/IGARSS.2011.6048975},
doi = {10.1109/IGARSS.2011.6048975},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/igarss/HeLLFL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/HeFLLL11,
author = {Chu He and
Qian Feng and
Ming Liu and
Xiaonian Liu and
Mingsheng Liao},
title = {Learning based decomposition for polarmetric {SAR} images},
booktitle = {2011 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2011, Vancouver, BC, Canada, July 24-29, 2011},
pages = {452--455},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/IGARSS.2011.6049162},
doi = {10.1109/IGARSS.2011.6049162},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/HeFLLL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnlp/ZhangDLXL11,
author = {Min Zhang and
Xiangyu Duan and
Ming Liu and
Yunqing Xia and
Haizhou Li},
title = {Joint Alignment and Artificial Data Generation: An Empirical Study
of Pivot-based Machine Transliteration},
booktitle = {Fifth International Joint Conference on Natural Language Processing,
{IJCNLP} 2011, Chiang Mai, Thailand, November 8-13, 2011},
pages = {1207--1215},
publisher = {The Association for Computer Linguistics},
year = {2011},
url = {https://aclanthology.org/I11-1135/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcnlp/ZhangDLXL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbsn/PengL10,
author = {Wei Peng and
Ming Liu},
title = {Online Gaming Dependency: {A} Preliminary Study in China},
journal = {Cyberpsychology Behav. Soc. Netw.},
volume = {13},
number = {3},
pages = {329--333},
year = {2010},
url = {https://doi.org/10.1089/cyber.2009.0082},
doi = {10.1089/CYBER.2009.0082},
timestamp = {Tue, 31 Mar 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cbsn/PengL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ccsecis/Liu10,
author = {Ming Liu},
title = {Semantic Clustering for Large-Scale Documents.doc},
journal = {Comput. Inf. Sci.},
volume = {3},
number = {1},
pages = {91--100},
year = {2010},
url = {https://doi.org/10.5539/cis.v3n1p91},
doi = {10.5539/CIS.V3N1P91},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ccsecis/Liu10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/orl/LiuS10,
author = {Ming Liu and
Jeremy Staum},
title = {Sensitivity analysis of the Eisenberg-Noe model of contagion},
journal = {Oper. Res. Lett.},
volume = {38},
number = {5},
pages = {489--491},
year = {2010},
url = {https://doi.org/10.1016/j.orl.2010.07.007},
doi = {10.1016/J.ORL.2010.07.007},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/orl/LiuS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsp/LiuHN10,
author = {Ming Liu and
Daniel W. C. Ho and
Yugang Niu},
title = {Robust Filtering Design for Stochastic System With Mode-Dependent
Output Quantization},
journal = {{IEEE} Trans. Signal Process.},
volume = {58},
number = {12},
pages = {6410--6416},
year = {2010},
url = {https://doi.org/10.1109/TSP.2010.2070496},
doi = {10.1109/TSP.2010.2070496},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsp/LiuHN10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/PervouchineZLL10,
author = {Vladimir Pervouchine and
Min Zhang and
Ming Liu and
Haizhou Li},
editor = {Chu{-}Ren Huang and
Dan Jurafsky},
title = {Improving Name Origin Recognition with Context Features and Unlabelled
Data},
booktitle = {{COLING} 2010, 23rd International Conference on Computational Linguistics,
Posters Volume, 23-27 August 2010, Beijing, China},
pages = {972--978},
publisher = {Chinese Information Processing Society of China},
year = {2010},
url = {https://aclanthology.org/C10-2112/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/PervouchineZLL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cse/ZhangBLX10,
author = {Liang Zhang and
Yuebin Bai and
Ming Liu and
Hanwen Xu},
title = {ColorCom2: {A} Transparent Co-located Virtual Machine Communication
Mechanism},
booktitle = {13th {IEEE} International Conference on Computational Science and
Engineering, {CSE} 2010, Hong Kong, China, December 11-13, 2010},
pages = {72--79},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/CSE.2010.19},
doi = {10.1109/CSE.2010.19},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cse/ZhangBLX10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ChenLLT10,
author = {Mo Chen and
Ming Liu and
Jianzhuang Liu and
Xiaoou Tang},
title = {Isoperimetric cut on a directed graph},
booktitle = {The Twenty-Third {IEEE} Conference on Computer Vision and Pattern
Recognition, {CVPR} 2010, San Francisco, CA, USA, 13-18 June 2010},
pages = {2109--2116},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/CVPR.2010.5539889},
doi = {10.1109/CVPR.2010.5539889},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/ChenLLT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/WangZLLM10,
author = {Xin{-}Jing Wang and
Lei Zhang and
Ming Liu and
Yi Li and
Wei{-}Ying Ma},
title = {{ARISTA} - image search to annotation on billions of web photos},
booktitle = {The Twenty-Third {IEEE} Conference on Computer Vision and Pattern
Recognition, {CVPR} 2010, San Francisco, CA, USA, 13-18 June 2010},
pages = {2987--2994},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/CVPR.2010.5540046},
doi = {10.1109/CVPR.2010.5540046},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/WangZLLM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/geoinformatics/WuZZLZZ10,
author = {Jianjun Wu and
Lei Zhou and
Jie Zhang and
Ming Liu and
Lin Zhao and
Feifei Zhao},
title = {Analysis of relationships among vegetation condition indices and multiple-time
scale {SPI} of grassland in growing season},
booktitle = {The 18th International Conference on Geoinformatics: GIScience in
Change, Geoinformatics 2010, Peking University, Beijing, China, June,
18-20, 2010},
pages = {1--6},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/GEOINFORMATICS.2010.5567752},
doi = {10.1109/GEOINFORMATICS.2010.5567752},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/geoinformatics/WuZZLZZ10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/LiWLZ10,
author = {Kunlun Li and
Miao Wang and
Ming Liu and
Aimin Zhao},
title = {Improved level set method for lip contour detection},
booktitle = {Proceedings of the International Conference on Image Processing, {ICIP}
2010, September 26-29, Hong Kong, China},
pages = {673--676},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ICIP.2010.5653112},
doi = {10.1109/ICIP.2010.5653112},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icip/LiWLZ10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/LiuCLL10,
author = {Ming Liu and
Mo Chen and
Jianzhuang Liu and
Hwann{-}Tzong Chen},
title = {Dimensionality Reduction via Tangential Learning},
booktitle = {Proceedings of the International Conference on Image Processing, {ICIP}
2010, September 26-29, Hong Kong, China},
pages = {853--856},
publisher = {{IEEE}},
year = {2010},
timestamp = {Fri, 06 Nov 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icip/LiuCLL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/LiuCL10,
author = {Ming Liu and
Shifeng Chen and
Jianzhuang Liu},
title = {Continuous {MRF} based image denoising with a closed form solution},
booktitle = {Proceedings of the International Conference on Image Processing, {ICIP}
2010, September 26-29, Hong Kong, China},
pages = {1137--1140},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ICIP.2010.5651364},
doi = {10.1109/ICIP.2010.5651364},
timestamp = {Thu, 25 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/LiuCL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/LiuCL10a,
author = {Ming Liu and
Mo Chen and
Jianzhuang Liu},
title = {Clustering on Dependency Digraphs},
booktitle = {Proceedings of the International Conference on Image Processing, {ICIP}
2010, September 26-29, Hong Kong, China},
pages = {1865--1868},
publisher = {{IEEE}},
year = {2010},
timestamp = {Tue, 14 Dec 2010 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icip/LiuCL10a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ZhouWZZLZ10,
author = {Lei Zhou and
Jianjun Wu and
Jie Zhang and
Feifei Zhao and
Ming Liu and
Lin Zhao},
title = {Assessing the drought monitoring characteristic of timeseries {NDVI}
indices in crop growing season},
booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium,
{IGARSS} 2010, July 25-30, 2010, Honolulu, Hawaii, USA, Proceedings},
pages = {2063--2066},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/IGARSS.2010.5652943},
doi = {10.1109/IGARSS.2010.5652943},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/ZhouWZZLZ10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iih-msp/LiuYL10,
author = {Ming Liu and
Nenghai Yu and
Weihai Li},
editor = {Isao Echizen and
Jeng{-}Shyang Pan and
Dieter W. Fellner and
Alexander Nouak and
Arjan Kuijper and
Lakhmi C. Jain},
title = {Camera Model Identification for {JPEG} Images via Tensor Analysis},
booktitle = {Sixth International Conference on Intelligent Information Hiding and
Multimedia Signal Processing {(IIH-MSP} 2010), Darmstadt, Germany,
15-17 October, 2010, Proceedings},
pages = {462--465},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/IIHMSP.2010.118},
doi = {10.1109/IIHMSP.2010.118},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iih-msp/LiuYL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ismvl/DubrovaTM10,
author = {Elena Dubrova and
Maxim Teslenko and
Ming Liu},
title = {Finding Attractors in Synchronous Multiple-Valued Networks Using SAT-Based
Bounded Model Checking},
booktitle = {40th {IEEE} International Symposium on Multiple-Valued Logic, {ISMVL}
2010, Barcelona, Spain, 26-28 May 2010},
pages = {144--149},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/ISMVL.2010.35},
doi = {10.1109/ISMVL.2010.35},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ismvl/DubrovaTM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ksem/DangXRL10,
author = {Yanzhong Dang and
Zhaoguo Xuan and
Lili Rong and
Ming Liu},
editor = {Yaxin Bi and
Mary{-}Anne Williams},
title = {A Novel Initialization Method for Semi-supervised Clustering},
booktitle = {Knowledge Science, Engineering and Management, 4th International Conference,
{KSEM} 2010, Belfast, Northern Ireland, UK, September 1-3, 2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6291},
pages = {317--328},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-15280-1\_30},
doi = {10.1007/978-3-642-15280-1\_30},
timestamp = {Thu, 14 Oct 2021 10:12:35 +0200},
biburl = {https://dblp.org/rec/conf/ksem/DangXRL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mvhi/WangLM10,
author = {Haijun Wang and
Ming Liu and
Wenlai Ma},
editor = {Honghua Tan},
title = {Color Image Segmentation Based on a New Geometric Active Contour Model},
booktitle = {2010 International Conference on Machine Vision and Human-machine
Interface, {MVHI} 2010, Kaifeng, China, April 24-25, 2010},
pages = {6--9},
publisher = {{IEEE} Computer Soceity},
year = {2010},
url = {https://doi.org/10.1109/MVHI.2010.75},
doi = {10.1109/MVHI.2010.75},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mvhi/WangLM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/ZhaoCXLN10,
author = {Min Zhao and
Baoqin Chen and
Changqing Xie and
Ming Liu and
Jiebing Nie},
title = {Study of process of {HSQ} in electron beam lithography},
booktitle = {5th {IEEE} International Conference on Nano/Micro Engineered and Molecular
Systems, {NEMS} 2010, Xiamen, China, January 20-23, 2010},
pages = {1021--1024},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/NEMS.2010.5592584},
doi = {10.1109/NEMS.2010.5592584},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nems/ZhaoCXLN10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robio/LiuX10,
author = {Ming Liu and
Demin Xu},
title = {An obstacle avoidance sonar based {SLAM} algorithm for {AUV} integrated
navigation},
booktitle = {2010 {IEEE} International Conference on Robotics and Biomimetics,
{ROBIO} 2010, Tianjin, China, December 14-18, 2010},
pages = {797--802},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ROBIO.2010.5723428},
doi = {10.1109/ROBIO.2010.5723428},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/robio/LiuX10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rskt/LiCCL10,
author = {Kunlun Li and
Zheng Cao and
Liping Cao and
Ming Liu},
editor = {Jian Yu and
Salvatore Greco and
Pawan Lingras and
Guoyin Wang and
Andrzej Skowron},
title = {An Improved {FCM} Algorithm for Image Segmentation},
booktitle = {Rough Set and Knowledge Technology - 5th International Conference,
{RSKT} 2010, Beijing, China, October 15-17, 2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6401},
pages = {551--556},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-16248-0\_75},
doi = {10.1007/978-3-642-16248-0\_75},
timestamp = {Mon, 16 Mar 2020 17:44:10 +0100},
biburl = {https://dblp.org/rec/conf/rskt/LiCCL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/LiuNS10,
author = {Ming Liu and
Barry L. Nelson and
Jeremy Staum},
title = {Simulation on demand for pricing many securities},
booktitle = {Proceedings of the 2010 Winter Simulation Conference, {WSC} 2010,
Baltimore, Maryland, USA, 5-8 December 2010},
pages = {2782--2789},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/WSC.2010.5678973},
doi = {10.1109/WSC.2010.5678973},
timestamp = {Thu, 10 Jun 2021 22:20:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/LiuNS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/LiuNS10a,
author = {Ming Liu and
Barry L. Nelson and
Jeremy Staum},
title = {An efficient simulation procedure for point estimation of expected
shortfall},
booktitle = {Proceedings of the 2010 Winter Simulation Conference, {WSC} 2010,
Baltimore, Maryland, USA, 5-8 December 2010},
pages = {2821--2831},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/WSC.2010.5678977},
doi = {10.1109/WSC.2010.5678977},
timestamp = {Thu, 10 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/LiuNS10a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/automatica/LiuHN09,
author = {Ming Liu and
Daniel W. C. Ho and
Yugang Niu},
title = {Stabilization of Markovian jump linear system over networks with random
communication delay},
journal = {Autom.},
volume = {45},
number = {2},
pages = {416--421},
year = {2009},
url = {https://doi.org/10.1016/j.automatica.2008.06.023},
doi = {10.1016/J.AUTOMATICA.2008.06.023},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/automatica/LiuHN09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chb/CoursarisL09,
author = {Constantinos K. Coursaris and
Ming Liu},
title = {An analysis of social support exchanges in online {HIV/AIDS} self-help
groups},
journal = {Comput. Hum. Behav.},
volume = {25},
number = {4},
pages = {911--918},
year = {2009},
url = {https://doi.org/10.1016/j.chb.2009.03.006},
doi = {10.1016/J.CHB.2009.03.006},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/chb/CoursarisL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chb/LiuP09,
author = {Ming Liu and
Wei Peng},
title = {Cognitive and psychological predictors of the negative outcomes associated
with playing MMOGs (massively multiplayer online games)},
journal = {Comput. Hum. Behav.},
volume = {25},
number = {6},
pages = {1306--1311},
year = {2009},
url = {https://doi.org/10.1016/j.chb.2009.06.002},
doi = {10.1016/J.CHB.2009.06.002},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/chb/LiuP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijahuc/LiuL09,
author = {Ming Liu and
Ming T. Liu},
title = {A Power-Saving algorithm combing power management and power control
for multihop {IEEE} 802.11 ad hoc networks},
journal = {Int. J. Ad Hoc Ubiquitous Comput.},
volume = {4},
number = {3/4},
pages = {168--173},
year = {2009},
url = {https://doi.org/10.1504/IJAHUC.2009.024519},
doi = {10.1504/IJAHUC.2009.024519},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijahuc/LiuL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jdcta/HanLLZ09,
author = {Lansheng Han and
Ming Liu and
Qiwen Liu and
Mengsong Zou},
title = {Sub-connection Based Isolation Against Network Virus},
journal = {J. Digit. Content Technol. its Appl.},
volume = {3},
number = {1},
pages = {110--122},
year = {2009},
url = {http://www.aicit.org/jdcta/ppl/jdcta030115.pdf},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jdcta/HanLLZ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cse/LiuHZL09,
author = {Ming Liu and
Lansheng Han and
Mengsong Zou and
Qiwen Liu},
title = {An Evaluating Model for Anti-virus Ability Based on {AHP}},
booktitle = {Proceedings of the 12th {IEEE} International Conference on Computational
Science and Engineering, {CSE} 2009, Vancouver, BC, Canada, August
29-31, 2009},
pages = {394--398},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/CSE.2009.334},
doi = {10.1109/CSE.2009.334},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cse/LiuHZL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fskd/DongLZ09,
author = {Rencai Dong and
Ming Liu and
Jing{-}zhu Zhao},
editor = {Yixin Chen and
Hepu Deng and
Degan Zhang and
Yingyuan Xiao},
title = {Study on Variation of Forestland in Lugu Lake Scenery District Based
on Technique of Spatial Data Mining},
booktitle = {Sixth International Conference on Fuzzy Systems and Knowledge Discovery,
{FSKD} 2009, Tianjin, China, 14-16 August 2009, 6 Volumes},
pages = {215--219},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/FSKD.2009.736},
doi = {10.1109/FSKD.2009.736},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fskd/DongLZ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/grc/YanL09,
author = {Jianfeng Yan and
Ming Liu},
title = {Diagnosis result fusion algorithm in fault diagnosis system using
improved {D-S} theory},
booktitle = {The 2009 {IEEE} International Conference on Granular Computing, GrC
2009, Lushan Mountain, Nanchang, China, 17-19 August 2009},
pages = {662--667},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/GRC.2009.5255039},
doi = {10.1109/GRC.2009.5255039},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/grc/YanL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icig/LiuMLX09,
author = {Ming Liu and
Zhenjiang Miao and
Jia Li and
Zhan Xu},
title = {Design and Implementation of a Vision-Based Motion Capture System},
booktitle = {Proceedings of the Fifth International Conference on Image and Graphics,
{ICIG} 2009, Xi'an, Shanxi, China, 20-23 September 2009},
pages = {716--721},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ICIG.2009.187},
doi = {10.1109/ICIG.2009.187},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icig/LiuMLX09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnc/YeLLLL09,
author = {Mao Ye and
Yongguo Liu and
Ming Liu and
Fan Li and
Qihe Liu},
editor = {Haiying Wang and
Kay Soon Low and
Kexin Wei and
Junqing Sun},
title = {Blind Image Extraction by Using Local Smooth Information},
booktitle = {Fifth International Conference on Natural Computation, {ICNC} 2009,
Tianjian, China, 14-16 August 2009, 6 Volumes},
pages = {415--420},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ICNC.2009.84},
doi = {10.1109/ICNC.2009.84},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icnc/YeLLLL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispa/FuTCLP09,
author = {Cai Fu and
Fugui Tang and
Yongquan Cui and
Ming Liu and
Bing Peng},
title = {Grey Theory Based Nodes Risk Assessment in {P2P} Networks},
booktitle = {{IEEE} International Symposium on Parallel and Distributed Processing
with Applications, {ISPA} 2009, Chengdu, Sichuan, China, 10-12 August
2009},
pages = {479--483},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ISPA.2009.45},
doi = {10.1109/ISPA.2009.45},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ispa/FuTCLP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/LiuCLT09,
author = {Ming Liu and
Shifeng Chen and
Jianzhuang Liu and
Xiaoou Tang},
editor = {Wen Gao and
Yong Rui and
Alan Hanjalic and
Changsheng Xu and
Eckehard G. Steinbach and
Abdulmotaleb El{-}Saddik and
Michelle X. Zhou},
title = {Video completion via motion guided spatial-temporal global optimization},
booktitle = {Proceedings of the 17th International Conference on Multimedia 2009,
Vancouver, British Columbia, Canada, October 19-24, 2009},
pages = {537--540},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1631272.1631350},
doi = {10.1145/1631272.1631350},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mm/LiuCLT09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nanoarch/LiuYT009,
author = {Ming Liu and
Haigang Yang and
Sansiri Tanachutiwat and
Wei Wang},
title = {{FPGA} based on integration of carbon nanorelays and {CMOS} devices},
booktitle = {2009 {IEEE/ACM} International Symposium on Nanoscale Architectures,
{NANOARCH} 2009, San Francisco, CA, USA, July 30-31, 2009},
pages = {61--64},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/NANOARCH.2009.5226350},
doi = {10.1109/NANOARCH.2009.5226350},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nanoarch/LiuYT009.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/LiuS09,
author = {Ming Liu and
Jeremy Staum},
editor = {Ann Dunkin and
Ricki G. Ingalls and
Enver Y{\"{u}}cesan and
Manuel D. Rossetti and
Ray Hill and
Bj{\"{o}}rn Johansson},
title = {Estimating Expected Shortfall with Stochastic Kriging},
booktitle = {Proceedings of the 2009 Winter Simulation Conference, {WSC} 2009,
Hilton Austin Hotel, Austin, TX, USA, December 13-16, 2009},
pages = {1249--1260},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/WSC.2009.5429418},
doi = {10.1109/WSC.2009.5429418},
timestamp = {Thu, 10 Jun 2021 22:18:58 +0200},
biburl = {https://dblp.org/rec/conf/wsc/LiuS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbsn/PengLM08,
author = {Wei Peng and
Ming Liu and
Yi Mou},
title = {Do Aggressive People Play Violent Computer Games in a More Aggressive
Way? Individual Difference and Idiosyncratic Game-Playing Experience},
journal = {Cyberpsychology Behav. Soc. Netw.},
volume = {11},
number = {2},
pages = {157--161},
year = {2008},
url = {https://doi.org/10.1089/cpb.2007.0026},
doi = {10.1089/CPB.2007.0026},
timestamp = {Tue, 31 Mar 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cbsn/PengLM08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mcs/ChowLF08,
author = {Ying{-}Foon Chow and
Ming Liu and
Xinting Fan},
title = {Broad-market return persistence and momentum profits},
journal = {Math. Comput. Simul.},
volume = {78},
number = {2-3},
pages = {181--188},
year = {2008},
url = {https://doi.org/10.1016/j.matcom.2008.01.011},
doi = {10.1016/J.MATCOM.2008.01.011},
timestamp = {Wed, 04 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mcs/ChowLF08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icess/LiuLSW08,
author = {Rong Liu and
Ming Liu and
Xiaokun Sun and
Yawen Wei},
editor = {Shuvra S. Bhattacharyya and
Xingshe Zhou and
Bing Guo and
Zili Shao and
Xiangke Liao},
title = {Signal Processing and Accelerometer-based Design for Portable Small
Displacement Measurement Device},
booktitle = {International Conference on Embedded Software and Systems, {ICESS}
'08, Chengdu, Sichuan, China, July 29-31, 2008},
pages = {575--579},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/ICESS.2008.65},
doi = {10.1109/ICESS.2008.65},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icess/LiuLSW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnc/LiuZWZ08,
author = {Ming Liu and
Yi Zheng and
Bing Wang and
Yannian Zhang},
editor = {Maozu Guo and
Liang Zhao and
Lipo Wang},
title = {Optimization Design of Structural Engineering Based on Reliability
and Its Realization with Lingo},
booktitle = {Fourth International Conference on Natural Computation, {ICNC} 2008,
Jinan, Shandong, China, 18-20 October 2008, Volume 6},
pages = {525--529},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/ICNC.2008.59},
doi = {10.1109/ICNC.2008.59},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icnc/LiuZWZ08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/ShangLTW08,
author = {Liwei Shang and
Ming Liu and
Sansiri Tanachutiwat and
Wei Wang},
title = {Analyzing mixed carbon nanotube bundles: {A} current density study},
booktitle = {International Symposium on Circuits and Systems {(ISCAS} 2008), 18-21
May 2008, Sheraton Seattle Hotel, Seattle, Washington, {USA}},
pages = {173--176},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/ISCAS.2008.4541382},
doi = {10.1109/ISCAS.2008.4541382},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/ShangLTW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/LiuCL08,
author = {Ming Liu and
Shifeng Chen and
Jianzhuang Liu},
editor = {Abdulmotaleb El{-}Saddik and
Son Vuong and
Carsten Griwodz and
Alberto Del Bimbo and
K. Sel{\c{c}}uk Candan and
Alejandro Jaimes},
title = {Precise object cutout from images},
booktitle = {Proceedings of the 16th International Conference on Multimedia 2008,
Vancouver, British Columbia, Canada, October 26-31, 2008},
pages = {623--626},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1459359.1459444},
doi = {10.1145/1459359.1459444},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mm/LiuCL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nanoarch/Liu008,
author = {Ming Liu and
Wei Wang},
title = {rFGA: CMOS-nano hybrid {FPGA} using {RRAM} components},
booktitle = {2008 {IEEE} International Symposium on Nanoscale Architectures, {NANOARCH}
2008, Anaheim, CA, USA, June 12-13, 2008},
pages = {93--98},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/NANOARCH.2008.4585797},
doi = {10.1109/NANOARCH.2008.4585797},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nanoarch/Liu008.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nanonet/LiuYW08,
author = {Ming Liu and
Hua Yu and
Wei Wang},
editor = {Maggie X. Cheng},
title = {{FPAA} Based on Integration of {CMOS} and Nanojunction Devices for
Neuromorphic Applications},
booktitle = {Nano-Net - Third International {ICST} Conference, NanoNet 2008, Boston,
MA, USA, September 14-16, 2008, Revised Selected Papers},
series = {Lecture Notes of the Institute for Computer Sciences, Social Informatics
and Telecommunications Engineering},
volume = {3},
pages = {44--48},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-642-02427-6\_9},
doi = {10.1007/978-3-642-02427-6\_9},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nanonet/LiuYW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/waim/YeZL08,
author = {Xiaojun Ye and
Yawei Zhang and
Ming Liu},
title = {A Personalized (a, k)-Anonymity Model},
booktitle = {The Ninth International Conference on Web-Age Information Management,
{WAIM} 2008, July 20-22, 2008, Zhangjiajie, China},
pages = {341--348},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/WAIM.2008.22},
doi = {10.1109/WAIM.2008.22},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/waim/YeZL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/displays/ChenL07,
author = {Xiaohong Chen and
Ming Liu},
title = {Improvement of brightness and efficiency in organic light-emitting
diodes using 1, 3-bis(4-tert-butylphenyl-1, 3, 4-oxadiazoyl) phenylene
as the hole buffer layer},
journal = {Displays},
volume = {28},
number = {1},
pages = {31--34},
year = {2007},
url = {https://doi.org/10.1016/j.displa.2006.11.004},
doi = {10.1016/J.DISPLA.2006.11.004},
timestamp = {Wed, 16 May 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/displays/ChenL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/LingZL07,
author = {Bo Ling and
Michael Zeifman and
Ming Liu},
title = {A practical system for online diagnosis of control valve faults},
booktitle = {46th {IEEE} Conference on Decision and Control, {CDC} 2007, New Orleans,
LA, USA, December 12-14, 2007},
pages = {2572--2577},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/CDC.2007.4434224},
doi = {10.1109/CDC.2007.4434224},
timestamp = {Fri, 04 Mar 2022 13:27:03 +0100},
biburl = {https://dblp.org/rec/conf/cdc/LingZL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/HuangLZ07a,
author = {Maosong Huang and
Ming Liu and
O. C. Zienkiewicz},
editor = {Yong Shi and
G. Dick van Albada and
Jack J. Dongarra and
Peter M. A. Sloot},
title = {Stabilized Procedures for Finite Element Analysis in Saturated Soils
Under Cyclic Loading},
booktitle = {Computational Science - {ICCS} 2007, 7th International Conference,
Beijing, China, May 27 - 30, 2007, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {4489},
pages = {1105--1113},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-72588-6\_176},
doi = {10.1007/978-3-540-72588-6\_176},
timestamp = {Tue, 08 Nov 2022 08:34:35 +0100},
biburl = {https://dblp.org/rec/conf/iccS/HuangLZ07a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnc/FuWL07,
author = {Wenxiu Fu and
Bin Wang and
Ming Liu},
editor = {Jingsheng Lei and
JingTao Yao and
Qingfu Zhang},
title = {Real-Time and Multi-Video-Object Segmentation for Compressed Video
Sequences},
booktitle = {Third International Conference on Natural Computation, {ICNC} 2007,
Haikou, Hainan, China, 24-27 August 2007, Volume 3},
pages = {747--754},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/ICNC.2007.596},
doi = {10.1109/ICNC.2007.596},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icnc/FuWL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/LiLW07,
author = {Dayong Li and
Ming Liu and
Wei Wang},
title = {Fault Tolerance Circuit for {AM-OLED}},
booktitle = {International Symposium on Circuits and Systems {(ISCAS} 2007), 27-20
May 2007, New Orleans, Louisiana, {USA}},
pages = {2272--2274},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/ISCAS.2007.378840},
doi = {10.1109/ISCAS.2007.378840},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/LiLW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robio/XieSLG07,
author = {Shuangwei Xie and
Quanjun Song and
Ming Liu and
YunJian Ge},
title = {Research on a throwing information acquiring system for discus-throw
athletes},
booktitle = {{IEEE} International Conference on Robotics and Biomimetics, {ROBIO}
2007, Sanya, China, 15-28 December 2007},
pages = {394--398},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/ROBIO.2007.4522194},
doi = {10.1109/ROBIO.2007.4522194},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/robio/XieSLG07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robio/LiuYH07,
author = {Ming Liu and
Chaowei Yuan and
Tao Huang},
title = {A novel Real-coded Quantum Genetic Algorithm in radiation pattern
synthesis for smart antenna},
booktitle = {{IEEE} International Conference on Robotics and Biomimetics, {ROBIO}
2007, Sanya, China, 15-28 December 2007},
pages = {2023--2026},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/ROBIO.2007.4522478},
doi = {10.1109/ROBIO.2007.4522478},
timestamp = {Wed, 24 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/robio/LiuYH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robio/SongLTYG07,
author = {Quanjun Song and
Ming Liu and
Lina Tong and
Yong Yu and
YunJian Ge},
title = {Extraction of elbow joint intention from sEMG signals in horizontal
plane using cosine tuning functions},
booktitle = {{IEEE} International Conference on Robotics and Biomimetics, {ROBIO}
2007, Sanya, China, 15-28 December 2007},
pages = {2206--2211},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/ROBIO.2007.4522512},
doi = {10.1109/ROBIO.2007.4522512},
timestamp = {Wed, 03 Apr 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/robio/SongLTYG07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trecvid/CampbellHLNSTXYY07,
author = {Murray Campbell and
Alexander Haubold and
Ming Liu and
Apostol Natsev and
John R. Smith and
Jelena Tesic and
Lexing Xie and
Rong Yan and
Jun Yang},
editor = {Paul Over and
George Awad and
Wessel Kraaij and
Alan F. Smeaton},
title = {{IBM} Research {TRECVID-2007} Video Retrieval System},
booktitle = {{TRECVID} 2007 workshop participants notebook papers, Gaithersburg,
MD, USA, November 2007},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2007},
url = {http://www-nlpir.nist.gov/projects/tvpubs/tv7.papers/ibm.pdf},
timestamp = {Wed, 11 Mar 2020 17:00:44 +0100},
biburl = {https://dblp.org/rec/conf/trecvid/CampbellHLNSTXYY07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/displays/XuLCHTMX06,
author = {Zheng Xu and
Ming Liu and
Xiaohong Chen and
Yanbing Hou and
Feng Teng and
Lijian Meng and
Xurng Xu},
title = {The phase separation of polymer blends doped with low concentration
probed by transient electroluminescence},
journal = {Displays},
volume = {27},
number = {2},
pages = {45--49},
year = {2006},
url = {https://doi.org/10.1016/j.displa.2005.09.001},
doi = {10.1016/J.DISPLA.2005.09.001},
timestamp = {Wed, 16 May 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/displays/XuLCHTMX06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijia/XuLKG06,
author = {Cui Xu and
Ming Liu and
Bin Kong and
YunJian Ge},
title = {Stereo Vision-Based Estimation of Pose and Motion for Autonomous Landing
of an Unmanned Helicopter},
journal = {Int. J. Inf. Acquis.},
volume = {3},
number = {3},
pages = {181--190},
year = {2006},
url = {https://doi.org/10.1142/S0219878906000940},
doi = {10.1142/S0219878906000940},
timestamp = {Thu, 30 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijia/XuLKG06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijia/ChenLG06,
author = {Wenbing Chen and
Ming Liu and
YunJian Ge},
title = {System Designing for a Small-Scale Autonomous Helicopter},
journal = {Int. J. Inf. Acquis.},
volume = {3},
number = {4},
pages = {359--367},
year = {2006},
url = {https://doi.org/10.1142/S0219878906001106},
doi = {10.1142/S0219878906001106},
timestamp = {Thu, 30 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijia/ChenLG06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcst/WangLH06,
author = {Wei Wang and
Ming Liu and
Andrew Hsu},
title = {Hybrid Nanoelectronics: Future of Computer Technology},
journal = {J. Comput. Sci. Technol.},
volume = {21},
number = {6},
pages = {871--886},
year = {2006},
url = {https://doi.org/10.1007/s11390-006-0871-5},
doi = {10.1007/S11390-006-0871-5},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcst/WangLH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fskd/LiuDX06,
author = {Ming Liu and
Wen{-}hua Dou and
Rui Xiao},
editor = {Lipo Wang and
Licheng Jiao and
Guangming Shi and
Xue Li and
Jing Liu},
title = {Design of a Multi-model Fuzzy Controller for {AQM}},
booktitle = {Fuzzy Systems and Knowledge Discovery, Third International Conference,
{FSKD} 2006, Xi'an, China, September 24-28, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4223},
pages = {739--742},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11881599\_90},
doi = {10.1007/11881599\_90},
timestamp = {Tue, 14 May 2019 10:00:54 +0200},
biburl = {https://dblp.org/rec/conf/fskd/LiuDX06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gcc/LiuD06,
author = {Ming Liu and
Wen{-}hua Dou},
title = {Does Fast Responsive {AQM} Scheme Always Do Better},
booktitle = {Grid and Cooperative Computing - {GCC} 2006, 5th International Conference,
Changsha, Hunan, China, 21-23 October 2006, Proceedings},
pages = {245--248},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/GCC.2006.40},
doi = {10.1109/GCC.2006.40},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gcc/LiuD06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/LiuDX06,
author = {Ming Liu and
Wen{-}hua Dou and
Rui Xiao},
editor = {Vassil N. Alexandrov and
G. Dick van Albada and
Peter M. A. Sloot and
Jack J. Dongarra},
title = {Estimating Average Flow Delay in {AQM} Router},
booktitle = {Computational Science - {ICCS} 2006, 6th International Conference,
Reading, UK, May 28-31, 2006, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {3991},
pages = {1030--1033},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11758501\_165},
doi = {10.1007/11758501\_165},
timestamp = {Tue, 14 May 2019 10:00:48 +0200},
biburl = {https://dblp.org/rec/conf/iccS/LiuDX06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icic/LiuZNC06,
author = {Ming Liu and
Hong Fu Zuo and
Xian Cun Ni and
Jing Cai},
editor = {De{-}Shuang Huang and
Kang Li and
George W. Irwin},
title = {Research on a Case-Based Decision Support System for Aircraft Maintenance
Review Board Report},
booktitle = {Intelligent Computing, International Conference on Intelligent Computing,
{ICIC} 2006, Kunming, China, August 16-19, 2006. Proceedings, Part
{I}},
series = {Lecture Notes in Computer Science},
volume = {4113},
pages = {1030--1039},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11816157\_125},
doi = {10.1007/11816157\_125},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/icic/LiuZNC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/LiuEG06,
author = {Ming Liu and
Gregory K. Egan and
YunJian Ge},
title = {Identification of Attitude Flight Dynamics for An Unconventional {UAV}},
booktitle = {2006 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, {IROS} 2006, October 9-15, 2006, Beijing, China},
pages = {3243--3248},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/IROS.2006.282431},
doi = {10.1109/IROS.2006.282431},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/LiuEG06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isda/WeiMYL06,
author = {Zhaobi Wei and
Zhiying Ma and
Huan Yang and
Ming Liu},
title = {Research on the Temperature Compensation of Optical Fiber Displacement
Sensor Based on Multisensor Data Fusion},
booktitle = {Proceedings of the Sixth International Conference on Intelligent Systems
Design and Applications {(ISDA} 2006), October 16-18, 2006, Jinan,
China},
pages = {562--566},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ISDA.2006.253898},
doi = {10.1109/ISDA.2006.253898},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isda/WeiMYL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isda/LiuZL06,
author = {Rong Liu and
Jianzhong Zhou and
Ming Liu},
title = {Graph-based Semi-supervised Learning Algorithm for Web Page Classification},
booktitle = {Proceedings of the Sixth International Conference on Intelligent Systems
Design and Applications {(ISDA} 2006), October 16-18, 2006, Jinan,
China},
pages = {856--860},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ISDA.2006.253724},
doi = {10.1109/ISDA.2006.253724},
timestamp = {Fri, 01 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isda/LiuZL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isnn/WangGWCDL06,
author = {Mingfeng Wang and
Zhi Geng and
Miqu Wang and
Feng Chen and
Weijun Ding and
Ming Liu},
editor = {Jun Wang and
Zhang Yi and
Jacek M. Zurada and
Bao{-}Liang Lu and
Hujun Yin},
title = {Combination of Network Construction and Cluster Analysis and Its Application
to Traditional Chinese Medicine},
booktitle = {Advances in Neural Networks - {ISNN} 2006, Third International Symposium
on Neural Networks, Chengdu, China, May 28 - June 1, 2006, Proceedings,
Part {III}},
series = {Lecture Notes in Computer Science},
volume = {3973},
pages = {777--785},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11760191\_114},
doi = {10.1007/11760191\_114},
timestamp = {Tue, 14 May 2019 10:00:36 +0200},
biburl = {https://dblp.org/rec/conf/isnn/WangGWCDL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robio/SongSXGLYG06,
author = {Quanjun Song and
Huanghuan Shen and
Shuangwei Xie and
Zhen Gao and
Ming Liu and
Yong Yu and
YunJian Ge},
title = {A Study of real-time EMG-driven Arm Wrestling Robot},
booktitle = {{IEEE} International Conference on Robotics and Biomimetics, {ROBIO}
2006, Kunming, China, 17-20 December 2006},
pages = {1610--1615},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ROBIO.2006.340185},
doi = {10.1109/ROBIO.2006.340185},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/robio/SongSXGLYG06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/LeongL06,
author = {Hon Wai Leong and
Ming Liu},
editor = {Hisham Haddad},
title = {A multi-agent algorithm for vehicle routing problem with time window},
booktitle = {Proceedings of the 2006 {ACM} Symposium on Applied Computing (SAC),
Dijon, France, April 23-27, 2006},
pages = {106--111},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1141277.1141301},
doi = {10.1145/1141277.1141301},
timestamp = {Tue, 06 Nov 2018 11:06:49 +0100},
biburl = {https://dblp.org/rec/conf/sac/LeongL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gcc/LiuDZ05,
author = {Ming Liu and
Wen{-}hua Dou and
He{-}ying Zhang},
editor = {Hai Zhuge and
Geoffrey C. Fox},
title = {The Effect of Router Buffer Size on Queue Length-Based {AQM} Schemes},
booktitle = {Grid and Cooperative Computing - {GCC} 2005, 4th International Conference,
Beijing, China, November 30 - December 3, 2005, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3795},
pages = {1185--1191},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11590354\_142},
doi = {10.1007/11590354\_142},
timestamp = {Tue, 14 May 2019 10:00:48 +0200},
biburl = {https://dblp.org/rec/conf/gcc/LiuDZ05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ibpria/ShangYZJL05,
author = {Yanfeng Shang and
Xin Yang and
Ming Zhu and
Biao Jin and
Ming Liu},
editor = {Jorge S. Marques and
Nicolas P{\'{e}}rez de la Blanca and
Pedro Pina},
title = {Prior Based Cardiac Valve Segmentation in Echocardiographic Sequences:
Geodesic Active Contour Guided by Region and Shape Prior},
booktitle = {Pattern Recognition and Image Analysis, Second Iberian Conference,
IbPRIA 2005, Estoril, Portugal, June 7-9, 2005, Proceedings, Part
{II}},
series = {Lecture Notes in Computer Science},
volume = {3523},
pages = {447--454},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11492542\_55},
doi = {10.1007/11492542\_55},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/ibpria/ShangYZJL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccnmc/LiuLL05,
author = {Ming Liu and
Ming T. Liu and
David Q. Liu},
editor = {Xicheng Lu and
Wei Zhao},
title = {Combining Power Management and Power Control in Multihop {IEEE} 802.11
Ad Hoc Networks},
booktitle = {Networking and Mobile Computing, Third International Conference, {ICCNMC}
2005, Zhangjiajie, China, August 2-4, 2005, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3619},
pages = {702--711},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11534310\_74},
doi = {10.1007/11534310\_74},
timestamp = {Fri, 09 Apr 2021 18:41:16 +0200},
biburl = {https://dblp.org/rec/conf/iccnmc/LiuLL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccnmc/DouLZZ05,
author = {Wen{-}hua Dou and
Ming Liu and
He{-}ying Zhang and
Yan{-}xing Zheng},
editor = {Xicheng Lu and
Wei Zhao},
title = {A Framework for Designing Adaptive {AQM} Schemes},
booktitle = {Networking and Mobile Computing, Third International Conference, {ICCNMC}
2005, Zhangjiajie, China, August 2-4, 2005, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3619},
pages = {789--799},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11534310\_83},
doi = {10.1007/11534310\_83},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccnmc/DouLZZ05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccsa/ShangYZJL05,
author = {Yanfeng Shang and
Xin Yang and
Ming Zhu and
Biao Jin and
Ming Liu},
editor = {Osvaldo Gervasi and
Marina L. Gavrilova and
Vipin Kumar and
Antonio Lagan{\`{a}} and
Heow Pueh Lee and
Youngsong Mun and
David Taniar and
Chih Jeng Kenneth Tan},
title = {Region and Shape Prior Based Geodesic Active Contour and Application
in Cardiac Valve Segmentation},
booktitle = {Computational Science and Its Applications - {ICCSA} 2005, International
Conference, Singapore, May 9-12, 2005, Proceedings, Part {IV}},
series = {Lecture Notes in Computer Science},
volume = {3483},
pages = {1102--1110},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11424925\_115},
doi = {10.1007/11424925\_115},
timestamp = {Thu, 28 Apr 2022 16:17:38 +0200},
biburl = {https://dblp.org/rec/conf/iccsa/ShangYZJL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isnn/LiuLZ04,
author = {Ming Liu and
Peng Liu and
Donghua Zhou},
editor = {Fuliang Yin and
Jun Wang and
Chengan Guo},
title = {Neural Network Based Fault Tolerant Control of a Class of Nonlinear
Systems with Input Time Delay},
booktitle = {Advances in Neural Networks - {ISNN} 2004, International Symposium
on Neural Networks, Dalian, China, August 19-21, 2004, Proceedings,
Part {II}},
series = {Lecture Notes in Computer Science},
volume = {3174},
pages = {91--96},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-28648-6\_14},
doi = {10.1007/978-3-540-28648-6\_14},
timestamp = {Thu, 09 Jan 2020 18:22:01 +0100},
biburl = {https://dblp.org/rec/conf/isnn/LiuLZ04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcta/LiuTW03,
author = {Ming Liu and
Chi K. Tse and
Jie Wu},
title = {A wavelet approach to fast approximation of steady-state waveforms
of power electronics circuits},
journal = {Int. J. Circuit Theory Appl.},
volume = {31},
number = {6},
pages = {591--610},
year = {2003},
url = {https://doi.org/10.1002/cta.252},
doi = {10.1002/CTA.252},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijcta/LiuTW03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/ChenLLG02,
author = {Xi Chen and
Yuhmei Lin and
Ming Liu and
Michael K. Gilson},
title = {The Binding Database: data management and interface design},
journal = {Bioinform.},
volume = {18},
number = {1},
pages = {130--139},
year = {2002},
url = {https://doi.org/10.1093/bioinformatics/18.1.130},
doi = {10.1093/BIOINFORMATICS/18.1.130},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/ChenLLG02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/MaLDL02,
author = {Debao Ma and
Ming Liu and
Yi{-}qun Deng and
Yi Lin},
title = {A piece-wise polynomial fitting method to filter the interferogram
phase noise [InSAR]},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2002, Toronto, Ontario, Canada, 24-28 June 2002},
pages = {3459--3461},
publisher = {{IEEE}},
year = {2002},
url = {https://doi.org/10.1109/IGARSS.2002.1027215},
doi = {10.1109/IGARSS.2002.1027215},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/igarss/MaLDL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/LiuCD02,
author = {Ming Liu and
Eric Chang and
Bei{-}qian Dai},
editor = {John H. L. Hansen and
Bryan L. Pellom},
title = {Hierarchical Gaussian mixture model for speaker verification},
booktitle = {7th International Conference on Spoken Language Processing, {ICSLP2002}
- {INTERSPEECH} 2002, Denver, Colorado, USA, September 16-20, 2002},
pages = {1353--1356},
publisher = {{ISCA}},
year = {2002},
url = {https://doi.org/10.21437/ICSLP.2002-411},
doi = {10.21437/ICSLP.2002-411},
timestamp = {Thu, 22 Jun 2023 16:42:18 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/LiuCD02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcomsys/FengL01a,
author = {Wu{-}chi Feng and
Ming Liu},
title = {Extending critical bandwidth allocation techniques for stored video
delivery across best-effort networks},
journal = {Int. J. Commun. Syst.},
volume = {14},
number = {10},
pages = {925--940},
year = {2001},
url = {https://doi.org/10.1002/dac.516},
doi = {10.1002/DAC.516},
timestamp = {Thu, 30 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijcomsys/FengL01a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jirs/LiuQ01,
author = {Ming Liu and
Nghe Huan Quach},
title = {Estimation and Compensation of Gravity and Friction Forces for Robot
Arms: Theory and Experiments},
journal = {J. Intell. Robotic Syst.},
volume = {31},
number = {4},
pages = {339--354},
year = {2001},
url = {https://doi.org/10.1023/A:1012089607929},
doi = {10.1023/A:1012089607929},
timestamp = {Tue, 07 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jirs/LiuQ01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/Liu00,
author = {Ming Liu},
title = {Stability analysis of decentralized adaptive fuzzy logic control for
robot arm tracking},
booktitle = {39th {IEEE} Conference on Decision and Control, {CDC} 2000, Sydney,
Australia, December 12-15, 2000},
pages = {883--888},
publisher = {{IEEE}},
year = {2000},
url = {https://doi.org/10.1109/CDC.2000.912882},
doi = {10.1109/CDC.2000.912882},
timestamp = {Thu, 31 Mar 2022 11:10:43 +0200},
biburl = {https://dblp.org/rec/conf/cdc/Liu00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdcs/FengL00,
author = {Wu{-}chi Feng and
Ming Liu},
title = {Critical Bandwidth Allocation Techniques for Stored Video Delivery
across Best-Effort Networks},
booktitle = {Proceedings of the 20th International Conference on Distributed Computing
Systems, Taipei, Taiwan, April 10-13, 2000},
pages = {56--63},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/ICDCS.2000.840907},
doi = {10.1109/ICDCS.2000.840907},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdcs/FengL00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/QuachL00,
author = {Nghe Huan Quach and
Ming Liu},
title = {A 3-Step Set-Point Control Algorithm for Robot Arms},
booktitle = {Proceedings of the 2000 {IEEE} International Conference on Robotics
and Automation, {ICRA} 2000, April 24-28, 2000, San Francisco, CA,
{USA}},
pages = {1296--1301},
publisher = {{IEEE}},
year = {2000},
url = {https://doi.org/10.1109/ROBOT.2000.844777},
doi = {10.1109/ROBOT.2000.844777},
timestamp = {Mon, 22 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/QuachL00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcamd/LiuW99,
author = {Ming Liu and
Shaomeng Wang},
title = {{MCDOCK:} {A} Monte Carlo simulation approach to the molecular docking
problem},
journal = {J. Comput. Aided Mol. Des.},
volume = {13},
number = {5},
pages = {435--451},
year = {1999},
url = {https://doi.org/10.1023/A:1008005918983},
doi = {10.1023/A:1008005918983},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcamd/LiuW99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tac/Liu99,
author = {Ming Liu},
title = {Decentralized control of robot manipulators: nonlinear and adaptive
approaches},
journal = {{IEEE} Trans. Autom. Control.},
volume = {44},
number = {2},
pages = {357--363},
year = {1999},
url = {https://doi.org/10.1109/9.746266},
doi = {10.1109/9.746266},
timestamp = {Wed, 20 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tac/Liu99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cira/KwanL99,
author = {Eddie Kwan and
Ming Liu},
title = {An adaptive fuzzy approach for robot manipulator tracking},
booktitle = {Proceedings 1999 {IEEE} International Symposium on Computational Intelligence
in Robotics and Automation, CIRA'99, Monterey, California, USA, November
8-9, 1999},
pages = {53--58},
publisher = {{IEEE}},
year = {1999},
url = {https://doi.org/10.1109/CIRA.1999.809946},
doi = {10.1109/CIRA.1999.809946},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/cira/KwanL99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wicsa/JaktmanLL99,
author = {Catherine Blake Jaktman and
John Leaney and
Ming Liu},
editor = {Patrick Donohoe},
title = {Structural Analysis of the Software Architecture - {A} Maintenance
Assessment Case Study},
booktitle = {Software Architecture, {TC2} First Working {IFIP} Conference on Software
Architecture (WICSA1), 22-24 February 1999, San Antonio, Texas, {USA}},
series = {{IFIP} Conference Proceedings},
volume = {140},
pages = {455--470},
publisher = {Kluwer},
year = {1999},
timestamp = {Wed, 16 Oct 2002 13:28:43 +0200},
biburl = {https://dblp.org/rec/conf/wicsa/JaktmanLL99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jhsn/FengLL98,
author = {Wu{-}chi Feng and
Chi{-}Chung Lam and
Ming Liu},
title = {Implementing fast bandwidth smoothing algorithms for the delivery
of compressed video streams},
journal = {J. High Speed Networks},
volume = {7},
number = {3-4},
pages = {281--299},
year = {1998},
url = {http://content.iospress.com/articles/journal-of-high-speed-networks/jhs150},
timestamp = {Mon, 18 May 2015 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jhsn/FengLL98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jirs/Liu97,
author = {Ming Liu},
title = {Decentralized {PD} and Robust Nonlinear Control for Robot Manipulators},
journal = {J. Intell. Robotic Syst.},
volume = {20},
number = {2-4},
pages = {319--332},
year = {1997},
url = {https://doi.org/10.1023/A:1007968513506},
doi = {10.1023/A:1007968513506},
timestamp = {Tue, 07 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jirs/Liu97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/Liu97,
author = {Ming Liu},
title = {Decentralized adaptive control for robot arm tracking},
booktitle = {Proceedings of the 1997 {IEEE} International Conference on Robotics
and Automation, Albuquerque, New Mexico, USA, April 20-25, 1997},
pages = {1731--1736},
publisher = {{IEEE}},
year = {1997},
url = {https://doi.org/10.1109/ROBOT.1997.614398},
doi = {10.1109/ROBOT.1997.614398},
timestamp = {Fri, 13 Aug 2021 09:26:01 +0200},
biburl = {https://dblp.org/rec/conf/icra/Liu97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/Liu95,
author = {Ming Liu},
title = {Conputed Torque Scheme Based Adptive Tracking for Robot Manipulators},
booktitle = {Proceedings of the 1995 International Conference on Robotics and Automation,
Nagoya, Aichi, Japan, May 21-27, 1995},
pages = {587--590},
publisher = {{IEEE} Computer Society},
year = {1995},
url = {https://doi.org/10.1109/ROBOT.1995.525347},
doi = {10.1109/ROBOT.1995.525347},
timestamp = {Fri, 13 Aug 2021 09:26:01 +0200},
biburl = {https://dblp.org/rec/conf/icra/Liu95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcom/LiuP93,
author = {Ming Liu and
P. Papantoni{-}Kazakos},
title = {A protocol for cellular radio signaling channels carrying data and
high-priority accessing requests},
journal = {{IEEE} Trans. Commun.},
volume = {41},
number = {4},
pages = {570--582},
year = {1993},
url = {https://doi.org/10.1109/26.223781},
doi = {10.1109/26.223781},
timestamp = {Fri, 16 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcom/LiuP93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcom/LiuP92,
author = {Ming Liu and
P. Papantoni{-}Kazakos},
title = {A random-access algorithm for data networks carrying high-priority
traffic},
journal = {{IEEE} Trans. Commun.},
volume = {40},
number = {1},
pages = {84--96},
year = {1992},
url = {https://doi.org/10.1109/26.126710},
doi = {10.1109/26.126710},
timestamp = {Fri, 16 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcom/LiuP92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/LiuP90,
author = {Ming Liu and
P. Papantoni{-}Kazakos},
title = {A Random Access Algorithm for Data Networks Carrying High Priority
Traffic},
booktitle = {Proceedings {IEEE} {INFOCOM} '90, The Conference on Computer Communications,
Ninth Annual Joint Conference of the {IEEE} Computer and Communications
Societies, The Multiple Facets of Integration, San Francisco, CA,
USA, June 3-7, 1990},
pages = {1087--1094},
publisher = {{IEEE} Computer Society},
year = {1990},
url = {https://doi.org/10.1109/INFCOM.1990.91361},
doi = {10.1109/INFCOM.1990.91361},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/infocom/LiuP90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
last updated on 2024-04-22 22:40 CEST by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
